DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and LOC103694882

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_008772072.1 Gene:LOC103694882 RGDID:9262100 Length:67 Species:Rattus norvegicus

Alignment Length:64 Identity:17/65 (26%)
Similarity:33/65 (51%) Gaps:4/65 (6%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWE 64
            ||....|    ||.|.:.|:..|:..:.:.::.::|.....|::::||...:|:|.|..|.:.|
  Rat     7 MDLLSAP----CRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDGKFILSE 66

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/65 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287
LOC103694882XP_008772072.1 Thioredoxin_like 3..66 CDD:294274 16/63 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.