DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and LOC100652871

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_011528968.1 Gene:LOC100652871 ID: Length:212 Species:Homo sapiens

Alignment Length:129 Identity:32/130 (25%)
Similarity:57/130 (44%) Gaps:12/130 (9%)


  Fly    65 SRAIAVYLVEKYGKDDYLLPNDPKKRAVIN-----QRLYFDMGTLYESFAKYYYPLFRTGKPGSD 124
            |.||..||..||....:..|.||..||.::     |...|.:......:.|...|.. ||:..|.
Human    38 SAAILYYLCRKYSAPSHWCPPDPHARARVDEFVAWQHTAFQLPMKKIVWLKLLIPKI-TGEEVSA 101

  Fly   125 EDLKR-IETAFG----FLDTFLEGQEYVAGDQLTVAD-IAILSTVSTFEVSEFDFSKYSNVSRW 182
            |.::. :|....    |.:.||:.:.::.|:|:::|| :|::..:.....:...|...|.::.|
Human   102 EKMEHAVEEVKNSLQLFEEKFLQDKMFITGNQISLADLVAVVEMMQPMAANYNVFLNSSKLAEW 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 5/9 (56%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/107 (21%)
LOC100652871XP_011528968.1 GstA <38..185 CDD:223698 32/130 (25%)
GST_C_Theta 62..188 CDD:198292 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.