DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alphaTry and gzm3.4

Sequence 1:NP_476771.1 Gene:alphaTry FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio

Alignment Length:255 Identity:73/256 (29%)
Similarity:121/256 (47%) Gaps:26/256 (10%)


  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            :||:|..|...||         ::..||||....:.|.|:..|||....|:|||.:...:.::|:
Zfish     8 IILISYSVIKTGG---------MESGIVGGREVKLHSRPYMASLQVQRKHNCGGILIKEDYVLTS 63

  Fly    70 AHCLQSVSASVLQVRAGS---TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSS 131
            |||.:..:.  |:|..|:   :...:...:.:|..:..|..|.......||.:::|.:....:..
Zfish    64 AHCWKDTTN--LEVVLGAHNISQRENSQQIIQVQKYIKHPNYQKKNHSFDIMLLKLKTKAVLNHF 126

  Fly   132 IKAISLATYNPANGA--SAAVSGWGTQ--SSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            :...:|..:.|:..|  ..:::|||.|  ..|:|::   |:.||:.:.|.|.|.|....|.:.  
Zfish   127 VNITNLPKHEPSILAPVECSIAGWGMQRPGEGASNV---LREVNLQLESNSYCKSKWQVYFNS-- 186

  Fly   193 NTMICAAASGKDA-CQGDSGGPLVSGGVLVGVVSWGY--GCAYSNYPGVYADVAVLRSWV 249
            ..|:|.|:.||.| ||||||.||.....|.|:.::.|  .|.:..||.||..|:....|:
Zfish   187 KNMVCTASDGKKAFCQGDSGSPLFCNSELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWI 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 67/229 (29%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 67/230 (29%)
Tryp_SPc 25..246 CDD:214473 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.