DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNaseII and dnase2

DIOPT Version :8

Sequence 1:NP_650672.1 Gene:DNaseII / 48228 FlyBaseID:FBgn0000477 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001039073.1 Gene:dnase2 / 733868 XenbaseID:XB-GENE-992625 Length:352 Species:Xenopus tropicalis

Alignment Length:372 Identity:120/373 (32%)
Similarity:179/373 (48%) Gaps:41/373 (11%)


  Fly     1 MRSLCFVLLFVWFFYQNEAKSKVSCKDEAGNDVDWWHLYKLPKHYQHNDLGKDTSGLKYLYVTSQ 65
            :|.|..::|.:..|      :..||..:.|..|||:.:||||   |..:.|:: :|:.|:|..|.
 Frog     3 LRLLMHLILPLGSF------AATSCYGDHGKQVDWFIVYKLP---QLRNKGEE-AGMTYMYQDSS 57

  Fly    66 NYDTWQMSGKFISDPLSLPAQTLNPL-----NDDPSHTLLAAYNDQQPNGTVFSSG---GHAKGV 122
            : ..|......::...|...||::.|     ..|.::.|   |||:..|  :.|||   ||.||:
 Frog    58 S-GGWVPGATLMNSTDSAVGQTVSQLYKAFGMKDVAYIL---YNDEPAN--ISSSGSDRGHTKGM 116

  Fly   123 VASDGETAIWIVHSVPKFPTIPDYSY--PTSGEQYAQSMLCVTLKGEDLEKVGQILVYNEPHFYY 185
            :..|.:...|:|||.|:||...|.||  |.|..:..||.||||...:....:||.|:||....|.
 Frog   117 LLLDKKQGFWLVHSTPRFPPPADQSYDWPLSAHRNGQSFLCVTYPYKQFGDIGQQLLYNTILPYD 181

  Fly   186 QRNPLATRSDELFPSLERALHGQWRTESPFQKDLEVRSLDGKKFRLFGKSGRANVELYADVVAPT 250
            ...|.....|  ||.|:.|......|:.|:.:.:.:.|:.||:|..|.|....:.:||:..|:..
 Frog   182 SSIPEDFSVD--FPELKTAAEKGAVTQPPWNRQVVLTSVGGKQFTSFSKHAHFSDDLYSGWVSQV 244

  Fly   251 LDVSLFVEAWRDGAGNLPNSCDKSDKVLNVESISNPELSVDFKTTQDHSKWAVSRPTGILIYHWR 315
            |...|||:.|::..|.||::|.......|:..| :...:..|.|..|||||.|:           
 Frog   245 LKSHLFVQFWQNSRGVLPSNCSLPFHTYNIMEI-DISCAYSFSTHNDHSKWCVT----------- 297

  Fly   316 VGGGDWICVGDINRQEGQLHRGGGTVCHKSARVSNLYRQLVTNYDKC 362
             .|..|.||||:||...:..|||||||.....|...:|.||::|:.|
 Frog   298 -DGAGWACVGDMNRDVKEERRGGGTVCVNDPNVWKSFRSLVSSYNNC 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNaseIINP_650672.1 PLDc_DNaseII_1 21..164 CDD:197219 53/153 (35%)
DNase_II 24..360 CDD:281283 115/346 (33%)
PLDc_DNaseII_2 213..362 CDD:197220 49/149 (33%)
dnase2NP_001039073.1 PLDc_SF 17..174 CDD:301585 56/167 (34%)
DNase_II 20..341 CDD:281283 115/346 (33%)
PLDc_SF 207..343 CDD:301585 49/149 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31563182
eggNOG 1 0.900 E1_KOG3825
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3803
OMA 1 1.010
OrthoDB 1 1.010 D422272at33208
OrthoFinder 1 1.000 FOG0001568
OrthoInspector 1 1.000 T601568
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2694
TreeFam 1 0.960
109.890

Return to query results.
Submit another query.