DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNaseII and DNASE2B

DIOPT Version :8

Sequence 1:NP_650672.1 Gene:DNaseII / 48228 FlyBaseID:FBgn0000477 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_067056.2 Gene:DNASE2B / 58511 HGNCID:28875 Length:361 Species:Homo sapiens

Alignment Length:368 Identity:120/369 (33%)
Similarity:188/369 (51%) Gaps:32/369 (9%)


  Fly     6 FVLLFVWFFYQNEAKSKVSCKDEAGNDVDWWHLYKLPKHYQHNDLGKDTSGLKYLYVTSQNYDTW 70
            |.|||:..|....| :.:||::|.|..|||:..|||||. |:.:.|:  :||:|||:.|.. .:|
Human    14 FALLFLGLFGVLGA-ATISCRNEEGKAVDWFTFYKLPKR-QNKESGE--TGLEYLYLDSTT-RSW 73

  Fly    71 QMSGKFISDPLSLPAQTLNPLND----DPSHTLLAAYNDQQPNGTVFS-SGGHAKGVVASDGETA 130
            :.|.:.::|..|:..:||..|.:    ..::|....|||..|....:| ..||.||::..:....
Human    74 RKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQG 138

  Fly   131 IWIVHSVPKFPTIPD--YSYPTSGEQYAQSMLCVTLKGEDLEKV-GQILVYNEPHFYYQRNPLAT 192
            .|::||:|:||.||:  |.||.:|.:..||.:|:|.|....|.: .|:||.| |:.|....| ||
Human   139 FWLIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCN-PNVYSCSIP-AT 201

  Fly   193 RSDEL--FPSL-ERALHGQWRTESPFQKDLEVRSLDGKKFRLFGKSGRANVELYADVVAPTLDVS 254
            ...||  .|.| .||.    .:|.|.:....::|..|:||..|.||.....:::|..:|..|...
Human   202 FHQELIHMPQLCTRAS----SSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTH 262

  Fly   255 LFVEAWRDGAGNLPNSCDKSDKVLNVESISNPELSVDFKTTQDHSKWAVSRPTGILIYHWRVGGG 319
            |..|.|:.....||::|.....|.|:::|.....|. |.:.|||:||.:|:         :....
Human   263 LLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSY-FSSYQDHAKWCISQ---------KGTKN 317

  Fly   320 DWICVGDINRQEGQLHRGGGTVCHKSARVSNLYRQLVTNYDKC 362
            .|.|:||:||...|..|.||.:|.::.::...::.||..|:.|
Human   318 RWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESC 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNaseIINP_650672.1 PLDc_DNaseII_1 21..164 CDD:197219 53/150 (35%)
DNase_II 24..360 CDD:281283 113/347 (33%)
PLDc_DNaseII_2 213..362 CDD:197220 42/149 (28%)
DNASE2BNP_067056.2 PLDc_DNaseII_beta_1 27..191 CDD:197286 60/170 (35%)
DNase_II 31..358 CDD:281283 113/347 (33%)
PLDc_DNaseII_beta_2 221..360 CDD:197288 42/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31561487
eggNOG 1 0.900 E1_KOG3825
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1052
Inparanoid 1 1.050 182 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422272at33208
OrthoFinder 1 1.000 FOG0001568
OrthoInspector 1 1.000 T609701
orthoMCL 1 0.900 OOG5_130788
Panther 1 1.100 O PTHR10858
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2694
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.