DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNaseII and crn-6

DIOPT Version :8

Sequence 1:NP_650672.1 Gene:DNaseII / 48228 FlyBaseID:FBgn0000477 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_499061.2 Gene:crn-6 / 176316 WormBaseID:WBGene00000799 Length:378 Species:Caenorhabditis elegans

Alignment Length:331 Identity:111/332 (33%)
Similarity:170/332 (51%) Gaps:28/332 (8%)


  Fly    25 CKDEAGNDVDWWHLYKLPKHYQHNDLGKDTSGLKYLYVTSQNYDTWQMSGKFISDPLSLPAQTLN 89
            |||..|::|||:..||||..:.|.|....::|..:||....| ..|::..:.:....:....||.
 Worm    21 CKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNN-KNWKLMPQGMDVENNAVYYTLQ 84

  Fly    90 P-LNDDPSHTLLAAYNDQQPNGTVFS-SGGHAKGVVASDGETAIWIVHSVPKFPTIPDYSYPTSG 152
            . .|.:.:.|....|||:.|:.|::| |.||||||...|..|..|::||:||||:...:.:|::.
 Worm    85 QYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNA 149

  Fly   153 EQYAQSMLCVTLKGEDLEKVGQILVYNEPHFYYQRNPLATRSDELFPSLERALHGQWRTESPFQK 217
            ..|.|..:|::.....|..:.|.|.|... |.||.| |.......||.|.:..:.::....|...
 Worm   150 HYYGQMGICISYNTVSLATIAQQLFYYNT-FTYQFN-LPQSFANQFPVLSQLKNKEYNKSPPLTS 212

  Fly   218 DLEVRSLDGKKFRLFGKSGRANVELYADVVAPTLDVSLFVEAWRDGAG---NLPNSCDKS--DKV 277
            ...::||.|:.||.|.|:|....:||:|.|.|||..|:.||.|...:|   |||:.||.:  ...
 Worm   213 TKVLKSLGGQHFRHFAKTGEWGKDLYSDFVGPTLKSSIKVETWNHQSGDEYNLPSVCDPNHVQST 277

  Fly   278 LNVESISNPELSVDFKTTQDHSKWAV------SRPTGILIYHWRVGGGDWICVGDINRQEGQLHR 336
            ::.:.|..| .::|:.:.:||||:.|      |:|.           ..::|:||||||..|:||
 Worm   278 MSAKYIRLP-YAIDYSSYEDHSKFVVAYSESSSKPP-----------IPYVCIGDINRQSHQIHR 330

  Fly   337 GGGTVC 342
            ||||:|
 Worm   331 GGGTMC 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNaseIINP_650672.1 PLDc_DNaseII_1 21..164 CDD:197219 48/141 (34%)
DNase_II 24..360 CDD:281283 111/332 (33%)
PLDc_DNaseII_2 213..362 CDD:197220 51/142 (36%)
crn-6NP_499061.2 PLDc_DNaseII_1 17..161 CDD:197219 48/141 (34%)
DNase_II 20..352 CDD:281283 111/332 (33%)
PLDc_DNaseII_2 208..356 CDD:197220 51/142 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31198388
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1052
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5194
OMA 1 1.010
OrthoDB 1 1.010 D422272at33208
OrthoFinder 1 1.000 FOG0001568
OrthoInspector 1 1.000 T375051
orthoMCL 1 0.900 OOG5_130788
Panther 1 1.100 O PTHR10858
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.