DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNaseII and crn-7

DIOPT Version :8

Sequence 1:NP_650672.1 Gene:DNaseII / 48228 FlyBaseID:FBgn0000477 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_498817.1 Gene:crn-7 / 176166 WormBaseID:WBGene00007056 Length:367 Species:Caenorhabditis elegans

Alignment Length:372 Identity:113/373 (30%)
Similarity:186/373 (50%) Gaps:45/373 (12%)


  Fly     4 LCFVLLFVWFFYQNEAKSKVSCKDEAGNDVDWWHLYKLPKHYQHNDLGKDTSGLKYLYVTSQNYD 68
            |.|||:|...|  .....|:.||:..|..|||:.:|||||.     .|..|||.:::|..:::.|
 Worm     3 LYFVLIFSVIF--TTGNGKIQCKNMRGKSVDWFVVYKLPKL-----SGAGTSGKEFVYFDAESSD 60

  Fly    69 TWQMSGKFISDP-LSLPAQTLNPLNDDPSHTLLAAYNDQQPNGTVFSSGGHAKGVVASDGETAIW 132
             | ..|..|:|| :::.|......:.|.|:.....|:|..|..:..|..||||||...|..|..|
 Worm    61 -W-TRGNDINDPNVAVGATVSQVYSADKSNNFWFMYSDDDPIKSADSYRGHAKGVSLFDSTTGFW 123

  Fly   133 IVHSVPKFPTIPDYSYPTSGEQYAQSMLCVTLKGEDLEKVGQILVYNEPHF-YYQRNP------- 189
            ::||||.||.|..:|||.:.|:|.||..|.:::.:.|.::.:       |: |.|..|       
 Worm   124 LIHSVPNFPPIKSFSYPNTAEKYGQSFFCASMEVQHLTELAE-------HWKYIQATPYIINIPE 181

  Fly   190 -LATRSDELFPSLE--RALHGQWRTESPFQKDLEVRSLDGKKFRLFGKSGRANVELYADVVAPTL 251
             .|||    ||:|:  .|.....|:.:.|.....::::.|.....:.|..:.:.:::.|:::...
 Worm   182 KYATR----FPTLKNVEAKQSLPRSATQFWISKPIKTVQGVTLMAYAKHKKFDGDIWNDLISRQN 242

  Fly   252 DVSLFVEAWRDGAG-NLPNSCDKSDKVLNVESISNPELSVDFKTTQDHSKWAVSRPTGILIYHWR 315
            .|:|.||:|.:|:| ::..:|..:.:..:|..:.  ...::|.:::||||||||......|    
 Worm   243 KVTLAVESWLNGSGDDIHTTCTSTSQTHDVTEMR--VTGLNFASSKDHSKWAVSNSQTNPI---- 301

  Fly   316 VGGGDWICVGDINRQEGQLHRGGGTVCHKSARVSNLYRQLVTNYDKC 362
                  :|.||:|||:.||.||||.:|.::..:..||...|...:.|
 Worm   302 ------VCFGDMNRQKSQLKRGGGALCIQNRNLWQLYHSFVIQVEPC 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNaseIINP_650672.1 PLDc_DNaseII_1 21..164 CDD:197219 54/144 (38%)
DNase_II 24..360 CDD:281283 105/349 (30%)
PLDc_DNaseII_2 213..362 CDD:197220 39/150 (26%)
crn-7NP_498817.1 PLDc_DNaseII_1 18..155 CDD:197219 54/144 (38%)
DNase_II 21..340 CDD:281283 105/349 (30%)
PLDc_DNaseII_2 204..342 CDD:197220 39/150 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31198375
eggNOG 1 0.900 E1_KOG3825
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5194
OMA 1 1.010
OrthoDB 1 1.010 D422272at33208
OrthoFinder 1 1.000 FOG0001568
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130788
Panther 1 1.100 O PTHR10858
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2694
TreeFam 1 0.960
109.790

Return to query results.
Submit another query.