DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aprt and APT2

Sequence 1:NP_001286908.1 Gene:Aprt FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_178122.1 Gene:APT2 AraportID:AT1G80050 Length:192 Species:Arabidopsis thaliana

Alignment Length:171 Identity:65/172 (38%)
Similarity:102/172 (59%) Gaps:2/172 (1%)


  Fly     5 ISAEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEVIVGLD 69
            :..:.:|..:...|...|:|||.||:|:||...|.||.|..::.|:.||..:..  ...::.|::
plant     8 LQGDPRLKAISDAIRVIPHFPKTGIMFQDITTLLLDPVAFKHVVDIFVDRYKHM--NISLVAGVE 70

  Fly    70 SRGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLL 134
            :|||:|...||..:|....|:||.|||.|.|:|.||:||||.|..|:...|:|..::.:::|||:
plant    71 ARGFIFGPPIALAIGAKFVPLRKPGKLPGRVISEEYELEYGRDCLEMSVEAVKSEERALIIDDLV 135

  Fly   135 ATGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGK 175
            ||||:|.|:..|:.:.|..|||...|:.|...:|:.:|.||
plant   136 ATGGTLSASINLLERAGAEVVECACVVGLPKFKGQCKLKGK 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 65/168 (39%)
APT2NP_178122.1 PLN02293 1..187 CDD:177930 65/172 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1695
OMA 1 1.010
OrthoDB 1 1.010 D1291050at2759
OrthoInspector 1 1.000 T124496
orthoMCL 1 0.900 OOG5_127379
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.778 Consistency score
76.880

Return to query results.
Submit another query.