DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aprt and APT1

Sequence 1:NP_001286908.1 Gene:Aprt FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001185104.1 Gene:APT1 AraportID:AT1G27450 Length:284 Species:Arabidopsis thaliana

Alignment Length:197 Identity:69/198 (35%)
Similarity:107/198 (54%) Gaps:31/198 (16%)


  Fly     5 ISAED----KLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEVI 65
            ::.||    ::..:.|.|...|:|||.||:|:||...|.|.:|......|.||..::..  ..|:
plant    77 MATEDVQDPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVDRYKDKG--ISVV 139

  Fly    66 VGLDSRGFLFNLLIATELGLGCAPIRKKGKLAG-------------------------EVVSVEY 105
            .|:::|||:|...||..:|....|:||..||.|                         :|:|.||
plant   140 AGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGTFLFLPLVACDFDIKLHERSQLGSWKVISEEY 204

  Fly   106 KLEYGIDTFELQKSAIKPGQKVVVVDDLLATGGSLVAATELIGKVGGVVVESLVVMELVGLEGRK 170
            .||||.||.|:...|::||::.:::|||:||||:|.||..|:.:||..:||...|:||..|:|::
plant   205 SLEYGTDTIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKE 269

  Fly   171 RL 172
            :|
plant   270 KL 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 68/194 (35%)
APT1NP_001185104.1 PLN02293 77..284 CDD:177930 69/198 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H413
Inparanoid 1 1.050 146 1.000 Inparanoid score I1695
OMA 1 1.010
OrthoDB 1 1.010 D1291050at2759
OrthoInspector 1 1.000 T124496
orthoMCL 1 0.900 OOG5_127379
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.778 Consistency score
87.880

Return to query results.
Submit another query.