DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and APT1

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001185104.1 Gene:APT1 / 839636 AraportID:AT1G27450 Length:284 Species:Arabidopsis thaliana


Alignment Length:197 Identity:69/197 - (35%)
Similarity:107/197 - (54%) Gaps:31/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISAED----KLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEVI 65
            ::.||    ::..:.|.|...|:|||.||:|:||...|.|.:|......|.||..::..  ..|:
plant    77 MATEDVQDPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVDRYKDKG--ISVV 139

  Fly    66 VGLDSRGFLFNLLIATELGLGCAPIRKKGKLAG-------------------------EVVSVEY 105
            .|:::|||:|...||..:|....|:||..||.|                         :|:|.||
plant   140 AGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGTFLFLPLVACDFDIKLHERSQLGSWKVISEEY 204

  Fly   106 KLEYGIDTFELQKSAIKPGQKVVVVDDLLATGGSLVAATELIGKVGGVVVESLVVMELVGLEGRK 170
            .||||.||.|:...|::||::.:::|||:||||:|.||..|:.:||..:||...|:||..|:|::
plant   205 SLEYGTDTIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKE 269

  Fly   171 RL 172
            :|
plant   270 KL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 68/193 (35%)
APT1NP_001185104.1 PLN02293 77..284 CDD:177930 69/197 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I2348
eggNOG 1 0.900 - - E1_COG0503
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H413
Inparanoid 1 1.050 146 1.000 Inparanoid score I1747
OMA 1 1.010 - - QHG62323
OrthoDB 1 1.010 - - D1291050at2759
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - otm2722
orthoMCL 1 0.900 - - OOG6_101012
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1290
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.