DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and APT3

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_193988.1 Gene:APT3 / 828353 AraportID:AT4G22570 Length:183 Species:Arabidopsis thaliana


Alignment Length:184 Identity:82/184 - (44%)
Similarity:116/184 - (63%) Gaps:4/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPSISAED-KLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEV 64
            ||.:...|| ::..:|:||...|:|||:||:|:||...|.||||.....||.|:..|:.  ...|
plant     1 MSGNKEEEDPRIHGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDK--NISV 63

  Fly    65 IVGLDSRGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVV 129
            :.|:::|||||...||..:|....|:||..||.||.:..||:||||.|..|:...|::.|.:.:|
plant    64 VAGIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHIGAVEAGDRALV 128

  Fly   130 VDDLLATGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGK-VHSLIKY 182
            ||||:||||:|.||..|:.:||..|||...|:||..|:||:||.|| :..|::|
plant   129 VDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVEY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 78/174 (45%)
APT3NP_193988.1 PLN02293 1..183 CDD:177930 82/184 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I2348
eggNOG 1 0.900 - - E1_COG0503
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1747
OMA 1 1.010 - - QHG62323
OrthoDB 1 1.010 - - D1291050at2759
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - otm2722
orthoMCL 1 0.900 - - OOG6_101012
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1290
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.