DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aprt and APT3

Sequence 1:NP_001286908.1 Gene:Aprt FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_193988.1 Gene:APT3 AraportID:AT4G22570 Length:183 Species:Arabidopsis thaliana

Alignment Length:184 Identity:82/185 (44%)
Similarity:116/185 (63%) Gaps:4/185 (2%)


  Fly     1 MSPSISAED-KLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEV 64
            ||.:...|| ::..:|:||...|:|||:||:|:||...|.||||.....||.|:..|:.  ...|
plant     1 MSGNKEEEDPRIHGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDK--NISV 63

  Fly    65 IVGLDSRGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVV 129
            :.|:::|||||...||..:|....|:||..||.||.:..||:||||.|..|:...|::.|.:.:|
plant    64 VAGIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHIGAVEAGDRALV 128

  Fly   130 VDDLLATGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGK-VHSLIKY 182
            ||||:||||:|.||..|:.:||..|||...|:||..|:||:||.|| :..|::|
plant   129 VDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVEY 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 78/175 (45%)
APT3NP_193988.1 PLN02293 1..183 CDD:177930 82/185 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1695
OMA 1 1.010
OrthoDB 1 1.010 D1291050at2759
OrthoInspector 1 1.000 T124496
orthoMCL 1 0.900 OOG5_127379
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.778 Consistency score
76.880

Return to query results.
Submit another query.