DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aprt and APRT

Sequence 1:NP_001286908.1 Gene:Aprt FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_000476.1 Gene:APRT HGNCID:626 Length:180 Species:Homo sapiens

Alignment Length:178 Identity:82/179 (46%)
Similarity:116/179 (65%) Gaps:2/179 (1%)


  Fly     7 AEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRES-APEAEVIVGLDS 70
            |:.:|..|:.:|..:|:||..|::||||...|.||.:......||..|::.: ....:.|.||||
Human     2 ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDS 66

  Fly    71 RGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLLA 135
            |||||...:|.||||||..|||:|||.|..:...|.||||....|:||.|::|||:|||||||||
Human    67 RGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLA 131

  Fly   136 TGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRL-DGKVHSLIKY 182
            |||::.||.||:|::...|:|.:.::||..|:||::| .....||::|
Human   132 TGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQY 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 80/175 (46%)
APRTNP_000476.1 apt 9..179 CDD:273437 79/170 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239951449
eggNOG 1 0.900 E1_COG0503
Hieranoid 1 1.000
Homologene 1 1.000 H413
Inparanoid 1 1.050 151 1.000 Inparanoid score I4298
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1291050at2759
OrthoFinder 1 1.000 FOG0003380
OrthoInspector 1 1.000 T1072569
orthoMCL 1 0.900 OOG5_127379
Panther 1 1.100 LDO PTHR32315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R77
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.