DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aprt and apt1

Sequence 1:NP_001286908.1 Gene:Aprt FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_594433.1 Gene:apt1 PomBaseID:SPAC23A1.03 Length:188 Species:Schizosaccharomyces pombe

Alignment Length:174 Identity:79/175 (45%)
Similarity:119/175 (68%) Gaps:0/175 (0%)


  Fly     7 AEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEVIVGLDSR 71
            ::|:::|:|:|:.:||:|||:||||.||.....||:|...|.|||::.:.......:|||||::|
pombe     2 SDDRINYLKNKLVQYPDFPKKGILFEDIMPIFQDPRAFGILIDLLLEAVETEFNNIDVIVGLEAR 66

  Fly    72 GFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLLAT 136
            ||||...:|........|:||..||.|::|.|.|..||..|:|.:||..|||||:|::|||:|||
pombe    67 GFLFGPTLALRANCAFVPVRKPNKLPGDLVVVSYNKEYSTDSFAIQKGTIKPGQRVLIVDDILAT 131

  Fly   137 GGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGKVHSLI 180
            ||:.:||.||:.::||.:|..|.::||..|:|||||....::|:
pombe   132 GGTALAADELVTRLGGELVGHLFLLELTFLQGRKRLMAPTYTLL 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 79/173 (46%)
apt1NP_594433.1 PRK02304 8..176 CDD:235028 78/169 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H413
Inparanoid 1 1.050 164 1.000 Inparanoid score I1204
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003380
OrthoInspector 1 1.000 T1124418
orthoMCL 1 0.900 OOG5_127379
Panther 1 1.100 LDO PTHR32315
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R77
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.