DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aprt and Aprt

Sequence 1:NP_001286908.1 Gene:Aprt FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_033828.2 Gene:Aprt MGIID:88061 Length:180 Species:Mus musculus

Alignment Length:179 Identity:84/180 (47%)
Similarity:119/180 (66%) Gaps:4/180 (2%)


  Fly     7 AEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRES-APEAEVIVGLDS 70
            :|.:|..|..:|..:|:||..|:|||||...|.||.:......||..|::.: :.:.:.|.||||
Mouse     2 SEPELKLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRLLASHLKSTHSGKIDYIAGLDS 66

  Fly    71 RGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLLA 135
            |||||...:|.|||:||..|||:|||.|..||..|.||||....|:||.|::|||:||:||||||
Mouse    67 RGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLEYGKAELEIQKDALEPGQRVVIVDDLLA 131

  Fly   136 TGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGKV--HSLIKY 182
            |||::.||.:|:.::...|||.:.::||..|:||:|| |.:  .||::|
Mouse   132 TGGTMFAACDLLHQLRAEVVECVSLVELTSLKGRERL-GPIPFFSLLQY 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 82/176 (47%)
AprtNP_033828.2 PRK02304 6..180 CDD:235028 83/176 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239948699
eggNOG 1 0.900 E1_COG0503
Hieranoid 1 1.000
Homologene 1 1.000 H413
Inparanoid 1 1.050 151 1.000 Inparanoid score I4322
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003380
OrthoInspector 1 1.000 T1082635
orthoMCL 1 0.900 OOG5_127379
Panther 1 1.100 LDO PTHR32315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R77
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.