DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and zgc:174895

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001099174.1 Gene:zgc:174895 / 100126024 ZFINID:ZDB-GENE-070928-41 Length:200 Species:Danio rerio


Alignment Length:137 Identity:46/137 - (33%)
Similarity:73/137 - (53%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ALTDPKACVYLRDLLVDHIRESAPEAEVIVGLDSRGFLFNLLIATELGLGCAPIRKKGKLAGEVV 101
            ||:|   ||  :|||.....|:   .:::.|:|:.||:....:||.||.|...|||.|.|..|..
Zfish    42 ALSD---CV--KDLLKPFQNET---IDLVAGIDAMGFILGSAVATTLGKGFLAIRKAGHLCVETH 98

  Fly   102 SVEYKLEYGID-TFELQKSAIKPGQKVVVVDDLLATGGSLVAATELIGKVGGVVVESLVVMELVG 165
            :.:|....|.: ..|::...:|||.:|::||..:.|||::.||.:|:...|..|| .:..:.:..
Zfish    99 TQDYSDYSGREKVMEVRVDVLKPGLRVLLVDQWIETGGTMRAAIKLVENQGATVV-GIAAVAIEN 162

  Fly   166 LEGRKRL 172
            .||.|.|
Zfish   163 SEGGKWL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 46/137 (34%)
zgc:174895NP_001099174.1 PRK02304 36..161 CDD:235028 42/127 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.