DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and HB21

DIOPT Version :10

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_179445.1 Gene:HB21 / 816370 AraportID:AT2G18550 Length:220 Species:Arabidopsis thaliana


Alignment Length:48 Identity:19/48 - (39%)
Similarity:28/48 - (58%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 QLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKR 211
            |:..||.:||.....:...::.||..|.|...:|.||||||||:|:.:
plant    69 QVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeodomain 154..210 CDD:459649 19/45 (42%)
HB21NP_179445.1 HOX 61..114 CDD:197696 18/44 (41%)

Return to query results.
Submit another query.