DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and CG4328

DIOPT Version :10

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster


Alignment Length:105 Identity:36/105 - (34%)
Similarity:49/105 - (46%) Gaps:12/105 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DDELSSSLNNGHDL-SDMERPRKV------RRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAM 188
            |.|....:..|:|. .|...|.|:      :|.||...|.|....:.:||.:..|....||:||.
  Fly   312 DYEKEVEMLQGYDFYGDELFPPKLDGRRGPKRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAK 376

  Fly   189 RLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQG 228
            ...||...|||||||:|||.:|.:|...|:.     |.:|
  Fly   377 DTGLSLRIVQVWFQNQRAKVKKIQKKAKQEP-----PSKG 411

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeodomain 154..210 CDD:459649 24/55 (44%)
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757