DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Sebox

DIOPT Version :10

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_032785.1 Gene:Sebox / 18292 MGIID:108012 Length:190 Species:Mus musculus


Alignment Length:191 Identity:64/191 - (33%)
Similarity:83/191 - (43%) Gaps:40/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQD 218
            ||.||||:..||.:|||.|....|||:.|||.||....|.||::|||||||||| |.:::     
Mouse    19 RRKRTTFSVGQLVELERVFAARPYPDISTREHLAQVTHLPEAKIQVWFQNRRAK-RIKDR----- 77

  Fly   219 KAGYLLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAAAAGLLPQHLMAP 283
            |.|.|.....||.....:|..|. ||..||:......|...|.:....|         ||     
Mouse    78 KPGALNSRLELPPNSCSLPDTPQ-LPWDPGTSSHPLHPTSSAQYTSACP---------PQ----- 127

  Fly   284 HYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGL-SAMSQVSPPCS 343
                            .|.|..|.|.|.:.:.|..:|  |...|..:|: |::.|:.|..|
Mouse   128 ----------------TSCLGPILGPGQSWSGAKVAA--PWGTSGASGIHSSLEQIVPQTS 170

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeodomain 154..210 CDD:459649 33/55 (60%)