powered by:
Protein Alignment fs(1)K10 and Chtf8
DIOPT Version :9
| Sequence 1: | NP_477491.1 |
Gene: | fs(1)K10 / 47781 |
FlyBaseID: | FBgn0000810 |
Length: | 463 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001351115.1 |
Gene: | Chtf8 / 214987 |
MGIID: | 2443370 |
Length: | 121 |
Species: | Mus musculus |
| Alignment Length: | 45 |
Identity: | 12/45 - (26%) |
| Similarity: | 18/45 - (40%) |
Gaps: | 10/45 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 KPF------RSGKINSGPGGNGNGNR--VNG--NNQMMFSSSQMP 94
||| ..||.:....|.|.|.: |.. .|:::|.:...|
Mouse 68 KPFAVLVKHTPGKQDCDEPGRGTGTQYLVTALIKNKILFKTRPKP 112
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| fs(1)K10 | NP_477491.1 |
None |
| Chtf8 | NP_001351115.1 |
Ctf8 |
13..113 |
CDD:312999 |
12/45 (27%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S5715 |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.