powered by:
Protein Alignment fs(1)K10 and Chtf8
DIOPT Version :9
Sequence 1: | NP_477491.1 |
Gene: | fs(1)K10 / 47781 |
FlyBaseID: | FBgn0000810 |
Length: | 463 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001351115.1 |
Gene: | Chtf8 / 214987 |
MGIID: | 2443370 |
Length: | 121 |
Species: | Mus musculus |
Alignment Length: | 45 |
Identity: | 12/45 - (26%) |
Similarity: | 18/45 - (40%) |
Gaps: | 10/45 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 KPF------RSGKINSGPGGNGNGNR--VNG--NNQMMFSSSQMP 94
||| ..||.:....|.|.|.: |.. .|:::|.:...|
Mouse 68 KPFAVLVKHTPGKQDCDEPGRGTGTQYLVTALIKNKILFKTRPKP 112
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
fs(1)K10 | NP_477491.1 |
None |
Chtf8 | NP_001351115.1 |
Ctf8 |
13..113 |
CDD:312999 |
12/45 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S5715 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.