DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)K10 and Chtf8

DIOPT Version :9

Sequence 1:NP_477491.1 Gene:fs(1)K10 / 47781 FlyBaseID:FBgn0000810 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001351115.1 Gene:Chtf8 / 214987 MGIID:2443370 Length:121 Species:Mus musculus


Alignment Length:45 Identity:12/45 - (26%)
Similarity:18/45 - (40%) Gaps:10/45 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KPF------RSGKINSGPGGNGNGNR--VNG--NNQMMFSSSQMP 94
            |||      ..||.:....|.|.|.:  |..  .|:::|.:...|
Mouse    68 KPFAVLVKHTPGKQDCDEPGRGTGTQYLVTALIKNKILFKTRPKP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)K10NP_477491.1 None
Chtf8NP_001351115.1 Ctf8 13..113 CDD:312999 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5715
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.