DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HB53

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:72 Identity:26/72 - (36%)
Similarity:39/72 - (54%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 KKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNR--RMKNKKNSQRQAN 451
            :||| .:..|...||..|.....:...::.::|..|.|..|||.:|||||  |.||||..:..|.
plant    71 RKRK-LTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEEYAK 134

  Fly   452 QQNNNNN 458
            .:|:::|
plant   135 LKNHHDN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 21/56 (38%)
HB53NP_201471.1 Homeodomain 71..125 CDD:459649 19/54 (35%)

Return to query results.
Submit another query.