DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HB40

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001329011.1 Gene:HB40 / 829827 AraportID:AT4G36740 Length:217 Species:Arabidopsis thaliana


Alignment Length:72 Identity:25/72 - (34%)
Similarity:38/72 - (52%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 KKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNR--RMKNKKNSQRQAN 451
            :||| .:..|...||..|.....:..:::..||..|.|..|||.:|||||  |.|||:..:....
plant    56 RKRK-LTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKNKRLEEEYNK 119

  Fly   452 QQNNNNN 458
            .:|:::|
plant   120 LKNSHDN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 22/56 (39%)
HB40NP_001329011.1 HOX 56..109 CDD:197696 20/53 (38%)

Return to query results.
Submit another query.