DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Nanog

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:168 Identity:49/168 - (29%)
Similarity:74/168 - (44%) Gaps:17/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 GPNYRPDQTTSAAAAAAYMNEAERH---VSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYS 356
            ||:..|....::.:..|....|..|   .|.....:.|...|.:..|...|....|:|.|.   |
Mouse     7 GPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPD---S 68

  Fly   357 SSGASGGLSVGAVGPCTP--NPGLHEWTGQVSVRKK--RKPYSKFQTLELEKEFLFNAYVSKQKR 417
            |:.....||       :|  :.|..|...:|..||:  |..:|:.|...|:..|....|:|.|:.
Mouse    69 STSPKQKLS-------SPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQM 126

  Fly   418 WELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNN 455
            .||:..|.|:.:|||.||||:|||.|:..:.|..:.:|
Mouse   127 QELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSN 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 24/57 (42%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 14/58 (24%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 24/58 (41%)
Homeodomain 98..153 CDD:459649 22/54 (41%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 15/28 (54%)
PTZ00395 <190..>250 CDD:185594
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.