DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxd9

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_012826755.2 Gene:hoxd9 / 100497640 XenbaseID:XB-GENE-485791 Length:278 Species:Xenopus tropicalis


Alignment Length:79 Identity:48/79 - (60%)
Similarity:60/79 - (75%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 PNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNR 438
            ||.....|....|.||||.||:|:||||||||||||.|:::.:|:|:||.|.|||||||||||||
 Frog   198 PNNPAANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNR 262

  Fly   439 RMKNKKNSQRQANQ 452
            |||.||.::.:.|:
 Frog   263 RMKMKKMNKEKGNK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 41/55 (75%)
hoxd9XP_012826755.2 Hox9_act 1..181 CDD:461369
Homeodomain 212..260 CDD:459649 34/47 (72%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.