DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and CG8388

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster

Alignment Length:374 Identity:87/374 - (23%)
Similarity:139/374 - (37%) Gaps:85/374 - (22%)


  Fly    55 KAQDDRGAHAEHTEHQCTWNSCDFRTENQVEF----ERHSYYHGYYL----NLLLQGKLECDLH- 110
            |:|:......||.:.||  :.|:...|:..|.    .|.....||.:    ..|.:|.|...|. 
  Fly   218 KSQEFNDYIREHYKVQC--HICNLPMEDFSEMLAHVRREHKQRGYAMCCNRKFLKRGVLVDHLRR 280

  Fly   111 ---PEIPACTAPARL------------MEKLPALGQNFRCGWTDCEREFVSIVEFQDHIVKHALF 160
               ||...|:...|:            |.::.:.|:.:||  ..|.:.|.|.|.::.|.:.|   
  Fly   281 HQDPETFKCSICGRVMGHRRSLELHMRMHEIKSRGRLYRC--EQCSKAFYSAVVYERHKLTH--- 340

  Fly   161 EYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHIS-THSNKKQVACFHCGELFRTKTTLFDHL 224
                  .|. |:.|..|  ..|.|...::|.:.:|:. .|.|.....|..||:..|.:..|..|:
  Fly   341 ------IPR-EQWKVPC--THCEKTYPSQYTMQQHVKLVHLNLYAKICDVCGKSIRGREALARHM 396

  Fly   225 RRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVNCYKCTMCDMTCSSASSLTTHIRYRHLKD-- 287
                |.:|...|.|                      .||.:||...::...|..||:..|..:  
  Fly   397 ----EEHTGGPQAA----------------------IKCHLCDSMLTTKYGLARHIKMMHTAENL 435

  Fly   288 KPLKCSECDTRCVRESDLAKHVQIVHSKT-VHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYA 351
            :|::|..|...|........|::..|:.. .|||  |.|..:.:...:::.|.....|.  :||.
  Fly   436 QPMQCEFCLKICPSLQAHQHHIKYTHNTARSHQC--PMCEKAFKRPNELKEHMTTHTGE--VLYT 496

  Fly   352 CHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENGFYRLETTR 400
            |..|.:.|.|..::.||..|.|       .|.:    :||...||..:|
  Fly   497 CPHCPQTFNSNANMHAHRKKVH-------RKEW----EENRHKRLNRSR 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 4/17 (24%)
C2H2 Zn finger 207..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 237..257 CDD:275368 1/19 (5%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 4/18 (22%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368 4/16 (25%)
C2H2 Zn finger 289..309 CDD:275368 2/19 (11%)
C2H2 Zn finger 320..340 CDD:275368 6/21 (29%)
C2H2 Zn finger 350..369 CDD:275368 5/20 (25%)
C2H2 Zn finger 440..461 CDD:275368 4/20 (20%)
C2H2 Zn finger 469..489 CDD:275368 4/21 (19%)
C2H2 Zn finger 497..515 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.