DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and Hinfp

DIOPT Version :8

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_002727096.1 Gene:Hinfp / 300665 RGDID:1311492 Length:514 Species:Rattus norvegicus

Alignment Length:472 Identity:161/472 - (34%)
Similarity:237/472 - (50%) Gaps:54/472 - (11%)


  Fly    13 PPGKRKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLE---HYAKAQDDRGAHAEHTEHQCTWN 74
            ||||..:...|.|.|.|..|..:|:.......|:..||:   |.:|.:::.....|. |..|.|.
  Rat     3 PPGKVPRKENLGLQCEWGSCSFVCSAMEEFFDHVTQHLQQHIHGSKEEEEEEDLLEE-EFSCLWQ 66

  Fly    75 SCDF-RTENQVEFERHSYYHGYYLNLLLQG----KLECDLHPEIPACTAPARLMEKLPALGQNFR 134
            .|.| ..::..:..||.|:|.|:..|...|    :.:.||.|    |....:....:|....:|.
  Rat    67 ECGFCSLDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLSP----CILDFQSRNVIPDTPDHFL 127

  Fly   135 CGWTDCEREFVSIVEFQDHIVKHAL-FEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHIST 198
            |.|..||..|.:...|..|:..|:| .||  |...:|.. ..:|.|..|.....::.:|.||:.:
  Rat   128 CLWEHCESVFDNPEWFYRHVDAHSLCCEY--QAVSKDNH-VVLCGWKGCTCTFKDRCKLREHLRS 189

  Fly   199 HSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVNCYKC 263
            |:.:|.|||..||.:|...|...||:|||...:...|||:.|.|.|||::||:.|:..|||.|||
  Rat   190 HTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQRFQCSHCSKRFATERLLRDHMRNHVNHYKC 254

  Fly   264 TMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSK-TVHQCEHPDCHY 327
            .:|||||...|||..|:|:||.:|:|.||..||..|....||.||:. .||| :.::|:..:|.:
  Rat   255 PLCDMTCPLPSSLRNHMRFRHSEDRPFKCDCCDYSCKNLIDLRKHLD-THSKESAYRCDFENCSF 318

  Fly   328 SVRTYTQMRRHFLEVH-GNNPILYACHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDEN 391
            |.|:.:.::.|..:|| |::...|.||.|::.|..|.:|:.||.|||.|:.||||.||.|:..|:
  Rat   319 SARSLSSVKSHHRKVHEGDSEPRYKCHVCDKCFTRGNNLTVHLRKKHQFKWPSGHPRFRYKEHED 383

  Fly   392 GFYRLETTRLESLEVTQQILSPQVNDSLAKPGTGSCYEIVDPTNTEFERIIVSNDP----NEAQL 452
            |:.||:..|.||:|:|||:|                           :::...:||    ||:.|
  Rat   384 GYMRLQLVRYESVELTQQLL---------------------------QQLQEGSDPGLALNESSL 421

  Fly   453 MG---EVVISLPSLAEE 466
            .|   |.|:..|...||
  Rat   422 QGIVLETVLGGPGPEEE 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 4/16 (25%)
C2H2 Zn finger 207..225 CDD:275368 7/17 (41%)
C2H2 Zn finger 237..257 CDD:275368 9/19 (47%)
C2H2 Zn finger 263..284 CDD:275368 11/20 (55%)
C2H2 Zn finger 292..311 CDD:275368 8/18 (44%)
C2H2 Zn finger 352..373 CDD:275368 9/20 (45%)
HinfpXP_002727096.1 C2H2 Zn finger 171..190 CDD:275368 4/18 (22%)
C2H2 Zn finger 198..220 CDD:275368 10/21 (48%)
COG5048 <225..378 CDD:227381 70/153 (46%)
C2H2 Zn finger 228..248 CDD:275368 9/19 (47%)
C2H2 Zn finger 254..275 CDD:275368 11/20 (55%)
C2H2 Zn finger 283..303 CDD:275368 8/20 (40%)
C2H2 Zn finger 311..334 CDD:275368 5/22 (23%)
C2H2 Zn finger 344..362 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3608
Hieranoid 1 1.000
Homologene 1 1.000 H9174
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D564393at33208
OrthoFinder 1 1.000 FOG0005082
OrthoInspector 1 1.000 T1086176
orthoMCL 1 0.900 OOG5_132340
Panther 1 1.100 O PTHR24391
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.