DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and C04F5.9

DIOPT Version :8

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_504371.1 Gene:C04F5.9 / 178899 WormBaseID:WBGene00015451 Length:534 Species:Caenorhabditis elegans

Alignment Length:395 Identity:72/395 - (18%)
Similarity:125/395 - (31%) Gaps:135/395 - (34%)


  Fly    68 EHQCTWNSCDFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPALGQN 132
            :|:|.....:|...:::  :||...|     |:..|...|.|      |..   |..:..:|..:
 Worm     4 DHRCPQCLLEFPFASKL--QRHLETH-----LITGGDWLCGL------CDT---LFNRSSSLTNH 52

  Fly   133 FR--C-----GWTDCEREFVSIVEFQDHIVKHALFEYDI-QKTPEDERPKTMCNWAMCHKHMGNK 189
            :|  |     .:.|.|.:.:.:.:.::.:.:..|..|.. :|:||:  |.|..::          
 Worm    53 WRNSCAKVKMAFCDDELKEMLVYDLREAVFRMTLDHYSASEKSPEE--PGTSSSY---------- 105

  Fly   190 YRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHV 254
                   .|.|:.|...|.:| .|...:.||..|.         |....:|    ...::.::.|
 Worm   106 -------KTASDDKTSICIYC-NLLMPRGTLHHHY---------SVHTGRC----CPAEITQNSV 149

  Fly   255 VRHVNCYKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSEC------------DTRCVRESDLAK 307
            |.:|    |.:|........||..|  :||      ||:|.            ....|...||.|
 Worm   150 VPYV----CDLCGFGFRYKKSLYNH--WRH------KCTEVLAHFPDGGNIENQELNVMVEDLVK 202

  Fly   308 HVQIVH-----SK--------------------------------------------TVHQCEHP 323
            ..::::     ||                                            :..:|  |
 Worm   203 RAEVINPIELPSKRDGEDIEKEDSGDIDDDEETSPYFTAPITALSFDLQDWNVENVSSTEEC--P 265

  Fly   324 DCHYSVRTYTQMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHL---MKKHGFRLPSGHKRFT 385
            .|:....:..::.:|....||.....:.|..|...|...:.|.|||   .|.....:|...||..
 Worm   266 KCNRYFHSLGRLDQHTHAFHGTARPGFVCKLCRMKFAENRILLAHLRSGCKPMRVEVPDEKKRKK 330

  Fly   386 YRVDE 390
            ...:|
 Worm   331 MSAEE 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 0/16 (0%)
C2H2 Zn finger 207..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 237..257 CDD:275368 3/19 (16%)
C2H2 Zn finger 263..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 292..311 CDD:275368 6/30 (20%)
C2H2 Zn finger 352..373 CDD:275368 8/23 (35%)
C04F5.9NP_504371.1 C2H2 Zn finger 7..27 CDD:275368 4/21 (19%)
C2H2 Zn finger 36..54 CDD:275368 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.