DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aPKC and Prkca

Sequence 1:NP_001260984.1 Gene:aPKC FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:XP_017452495.1 Gene:Prkca RGDID:3395 Length:688 Species:Rattus norvegicus

Alignment Length:667 Identity:230/668 (34%)
Similarity:302/668 (45%) Gaps:211/668 (32%)


  Fly   483 RRGARRWRKLYRVNGHIFQAKRFNRRAFCAYCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKHC 547
            |:||.|.:.::.|..|.|.|:.|.:..||::|.|.|||.|:|||:|..|..:|||:||:.|...|
  Rat    22 RKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC 86

  Fly   548 --------TDQPEP--------------------------------------------------- 553
                    ||.|..                                                   
  Rat    87 PGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLC 151

  Fly   554 ------------LVKERAEES-------------------SDP------IPVP------------ 569
                        |..|..:|.                   |||      ||.|            
  Rat   152 GMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIR 216

  Fly   570 ----------------------------------------------------LP----------- 571
                                                                :|           
  Rat   217 STLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQE 281

  Fly   572 -------PLPYEAMSGGAEACETHDHAHIVAP------PPPEDPLEPGTQ-RQYSLNDFELIRVI 622
                   |:|.....|..|..:..:.|.: .|      .|.||..:|... .:..|.||..:.|:
  Rat   282 EGEYYNVPIPEGDEEGNVELRQKFEKAKL-GPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVL 345

  Fly   623 GRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTP 687
            |:||:.||::.:.:.|..:||:|::||.:|..|:|::....||.|.......|||..|||||||.
  Rat   346 GKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTV 410

  Fly   688 SRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEG 752
            .||:||:|:|.|||||||:|:..:..|..|.|||||||:..:|||::||||||||||||:||.||
  Rat   411 DRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIDCSFLHKRGIIYRDLKLDNVMLDSEG 475

  Fly   753 HIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDL 817
            |||:.|:|||||.:..|.||.||||||:||||||:..:.||.||||||.||||||||||:.||  
  Rat   476 HIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPF-- 538

  Fly   818 AGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHP 882
                   |...||.|||.|:|..:..|:|||..|.|:.||.:.|:||.||||..|.. .|:..|.
  Rat   539 -------DGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGE-RDVREHA 595

  Fly   883 FFKNMDWELLERKQVTPPFKPRLD---------------SDRDLANFPPEFTGEAVQLTPDDDHV 932
            ||:.:|||.||.:::.|||||:::               ..:...||...||.....|||.|..|
  Rat   596 FFRRIDWEKLENREIQPPFKPKVNFCTKMHWLQWASRPSCGKGAENFDKFFTRGQPVLTPPDQLV 660

  Fly   933 IDNIDQSEFEGFEYVNP 949
            |.|||||:||||.||||
  Rat   661 IANIDQSDFEGFSYVNP 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556 26/60 (43%)
S_TKc 616..884 CDD:214567 142/268 (53%)
STKc_aPKC 620..947 CDD:270740 172/342 (50%)
PrkcaXP_017452495.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D143719at33208
OrthoFinder 1 1.000 FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.