DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and sia1

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001090821.1 Gene:sia1 / 100038038 XenbaseID:XB-GENE-482368 Length:240 Species:Xenopus tropicalis


Alignment Length:139 Identity:38/139 - (27%)
Similarity:59/139 - (42%) Gaps:31/139 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 VAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSE 345
            ||||:|                 :.:.||.::..|...|:..|:..||||...|..:|....:.|
 Frog   130 VAAPSA-----------------RSRRRTIYSKEQTHFLQNQFDLNPYPDFVNRCRIAKITAIPE 177

  Fly   346 SRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTS 410
            .|:|||||||||   :|.|...|           :|:|....||.:..|:::........::|:.
 Frog   178 PRIQVWFQNRRA---RHLPRAAT-----------SLSPQERKPPGSVGPRSSLCREAQHPEAWSE 228

  Fly   411 YQTPYELTP 419
            ...|.:..|
 Frog   229 VLIPSDSQP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 20/47 (43%)
sia1NP_001090821.1 Homeodomain 138..191 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..240 10/56 (18%)

Return to query results.
Submit another query.