DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SrpRbeta and ARF3

Sequence 1:NP_001261596.1 Gene:SrpRbeta FlyBaseID:FBgn0011509 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_014737.1 Gene:ARF3 SGDID:S000005620 Length:183 Species:Saccharomyces cerevisiae

Alignment Length:138 Identity:37/139 (27%)
Similarity:65/139 (47%) Gaps:10/139 (7%)


  Fly    47 GRKD--FLLTGLSESGKSAIFMQLIHGKFPATFTSIKENVGDYRTGSASARLVDIPGHYRVRDKC 109
            |.|:  .|:.||.::||:.|..:|...|...:..::..||......:....:.|:.|..|:|   
Yeast    14 GSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLR--- 75

  Fly   110 LELYKH---RAKGIVFVVDSVTAHKDIRDVADFLYTILSDSATQPCSVLVLCNKQDQTTAKSAQV 171
             .|::|   ....::||:|| :|...:.:..:.||:|:.:...:...:||..||||...|...|.
Yeast    76 -PLWRHYFPATTALIFVIDS-SARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQE 138

  Fly   172 IKSLLESE 179
            :...||.|
Yeast   139 VSDFLELE 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SrpRbetaNP_001261596.1 SR_beta 49..243 CDD:206691 36/137 (26%)
SRPRB 51..221 CDD:255367 35/133 (26%)
ARF3NP_014737.1 Arf6 9..177 CDD:206716 37/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.