DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur1 and Rspo3

DIOPT Version :10

Sequence 1:NP_001262954.1 Gene:Fur1 / 47220 FlyBaseID:FBgn0004509 Length:1478 Species:Drosophila melanogaster
Sequence 2:NP_001094460.1 Gene:Rspo3 / 498997 RGDID:1563246 Length:276 Species:Rattus norvegicus


Alignment Length:219 Identity:41/219 - (18%)
Similarity:73/219 - (33%) Gaps:80/219 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 YSPQYPRIPP-------------NNFGSSPSGGSKLPLGKVPPPNKSSYVTNNPLLNSAPPKQGY 877
            |..:||.|..             .||.:....|..|.|||              .|:|.|  :|.
  Rat    85 YGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGK--------------CLDSCP--EGL 133

  Fly   878 QQISATYGVI------------------LGKANG-KSNNNSK-----EKTNNKGN---------- 908
            :..:.|...:                  .||..| |....::     :..:.|||          
  Rat   134 EASNHTMECVSIVHCEASDWSSWSPCMKKGKTCGFKRGTETRVRDILQHPSAKGNLCPPTSETRT 198

  Fly   909 ------KSNNGNKGKSGGSSGNRKEQTTQSTIIQTSTSKNKYYRISQQQQQKNNKQDRNGVQTQR 967
                  |.:.|.:||.|..  .::::..:....:||:|.:|....|::..:::..::|...|.:|
  Rat   199 CIVQRKKCSKGERGKKGRE--RKRKKLNKEDKKETSSSDSKGLESSRETSEQHESKERQQQQKRR 261

  Fly   968 PKANSGEKSYDEKSRKVVGEITTN 991
            .:         ||.:|.|...|.:
  Rat   262 AR---------EKQQKSVSVSTVH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur1NP_001262954.1 S8_pro-domain 234..309 CDD:465126
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 332..621 CDD:173789
P_proprotein 701..787 CDD:460225
FU 1320..>1350 CDD:214589
Rspo3NP_001094460.1 Furin-like_2 42..142 CDD:464939 16/72 (22%)
TSP1_spondin 148..203 CDD:480609 7/54 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.