DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur1 and RSPO4

DIOPT Version :10

Sequence 1:NP_001262954.1 Gene:Fur1 / 47220 FlyBaseID:FBgn0004509 Length:1478 Species:Drosophila melanogaster
Sequence 2:XP_016883328.1 Gene:RSPO4 / 343637 HGNCID:16175 Length:266 Species:Homo sapiens


Alignment Length:58 Identity:15/58 - (25%)
Similarity:24/58 - (41%) Gaps:10/58 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1232 CLECNDSAYMFEDQCYDVCPVHTYPLDKFQAEED--EQDDEVTRGPVNPYSSSPMDHS 1287
            |:.|....|:::.:|...||..|.      |.::  |...|...||...:  ||..|:
Human   104 CIRCKRQFYLYKGKCLPTCPPGTL------AHQNTRECQGECELGPWGGW--SPCTHN 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur1NP_001262954.1 S8_pro-domain 234..309 CDD:465126
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 332..621 CDD:173789
P_proprotein 701..787 CDD:460225
FU 1320..>1350 CDD:214589
RSPO4XP_016883328.1 Furin-like_2 35..135 CDD:464939 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.