DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur1 and Rspo4

DIOPT Version :10

Sequence 1:NP_001262954.1 Gene:Fur1 / 47220 FlyBaseID:FBgn0004509 Length:1478 Species:Drosophila melanogaster
Sequence 2:NP_001035779.1 Gene:Rspo4 / 228770 MGIID:1924467 Length:228 Species:Mus musculus


Alignment Length:86 Identity:20/86 - (23%)
Similarity:36/86 - (41%) Gaps:14/86 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1209 VGEVGMTRDHSNT-----AACLK-WSDRKCLECNDSAYMFEDQCYDVCPVHTYPLDKFQAEEDEQ 1267
            :|..|:....:|.     |.|.. :|...|:.|....::::.:|...||..|  |......|.::
Mouse    75 LGFFGIRGQEANRCKKCGATCESCFSQDFCIRCKRRFHLYKGKCLPSCPPGT--LTHQSTRECQE 137

  Fly  1268 DDEVTRGPVNPYSS-SPMDHS 1287
            :.|     .:|:.| ||..|:
Mouse   138 ECE-----PSPWGSWSPCIHN 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur1NP_001262954.1 S8_pro-domain 234..309 CDD:465126
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 332..621 CDD:173789
P_proprotein 701..787 CDD:460225
FU 1320..>1350 CDD:214589
Rspo4NP_001035779.1 Furin-like_2 35..135 CDD:464939 13/61 (21%)
FU 85..128 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..228
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.