DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus205 and DNApol-delta

DIOPT Version :8

Sequence 1:NP_524881.2 Gene:mus205 / 47186 FlyBaseID:FBgn0002891 Length:2130 Species:Drosophila melanogaster
Sequence 2:NP_524099.2 Gene:DNApol-delta / 39746 FlyBaseID:FBgn0263600 Length:1092 Species:Drosophila melanogaster

Alignment Length:996 Identity:271/996 - (27%)
Similarity:408/996 - (40%) Gaps:177/996 - (17%)


  Fly  1231 QSSEQSVSSSAAQAELDRSSFLRQLEGSSQDRQHDLSFGL-----------------SHATLDNT 1278
            ::::.:|..:....||.....:....|..:.|...:|..|                 |.....:.
  Fly   157 RNNKDNVQEAVLMVELVEKLNIHGYNGDKKQRYIKISVTLPRFVAAASRLLKKEVIMSEIDFQDC 221

  Fly  1279 FGFKVNLENLQQAKADID---CNHLTIITLEVFVSTRGDLQPDPM-HDEIRCLFYAIEHSLPDEK 1339
            ..|:.|::...:...|.|   ||.:.:                || |..||     ..||.|   
  Fly   222 RAFENNIDFDIRFMVDTDVVGCNWIEL----------------PMGHWRIR-----NSHSKP--- 262

  Fly  1340 LPSKACGYIMVNTVQDLL----SEG------PFHGIDRDIE----------------VQVVT--- 1375
            ||...| .|.|:...|..    .||      ||..:..|||                :|:..   
  Fly   263 LPESRC-QIEVDVAFDRFISHEPEGEWSKVAPFRILSFDIECAGRKGIFPEAKIDPVIQIANMVI 326

  Fly  1376 --SEAEAFEALL-------------ALC--------ERW-------DADIYAGYEIEMSSWGYVI 1410
              .|.|.|...:             .||        ::|       |.||..||.|....:.|::
  Fly   327 RQGEREPFIRNVFTLNECAPIIGSQVLCHDKETQMLDKWSAFVREVDPDILTGYNINNFDFPYLL 391

  Fly  1411 DRAKHLCFNIAPLLSRVPTQKVRDFVDED---------RE-QFTDLDVEMKLCGRILLDVWRLMR 1465
            :||.||.......|.|:  :.:|..:.|.         || |:.:.:      ||:..|:..::.
  Fly   392 NRAAHLKVRNFEYLGRI--KNIRSVIKEQMLQSKQMGRRENQYVNFE------GRVPFDLLFVLL 448

  Fly  1466 SEIALTSYTFENVMYHILHKRCPWHTAKSLTE-WFGSPCTRWIVMEYYLERVRGTLTLLDQLDLL 1529
            .:..|.|||...|.||.|.::........:|: ..|...||..:..|.|:.....|.||::|..:
  Fly   449 RDYKLRSYTLNAVSYHFLQEQKEDVHHSIITDLQNGDEQTRRRLAMYCLKDAYLPLRLLEKLMAI 513

  Fly  1530 GRTSEMAKLIGIQFYEVLSRGSQFRVESMMLRIAKPKNLVPLSPSVQARAHMRAPEYLALIMEPQ 1594
            ....|||::.|:....:|:||.|.:|.|.:||.||.|..:  .||..::......|. |.::||:
  Fly   514 VNYMEMARVTGVPLESLLTRGQQIKVLSQLLRKAKTKGFI--MPSYTSQGSDEQYEG-ATVIEPK 575

  Fly  1595 SRFYADPLIVLDFQSLYPSMIIAYNYCFSTCLGRVEHLGGSSPFEFGASQLRVSRQML--QKLLE 1657
            ..:||||:..|||.|||||:::|:|.|::|.:     |||             :|:.|  |:.|:
  Fly   576 RGYYADPISTLDFASLYPSIMMAHNLCYTTLV-----LGG-------------TREKLRQQENLQ 622

  Fly  1658 HDLVTVSPCGVVFVKREVREGILPRMLTEILDTRQMVKQSMKLHKDSSALQRILHSRQLGLKLMA 1722
            .|.|..:|....|||.|||.|:||.:|..:|..|:..|..:|:..|... :::|..|||.||:.|
  Fly   623 DDQVERTPANNYFVKSEVRRGLLPEILESLLAARKRAKNDLKVETDPFK-RKVLDGRQLALKISA 686

  Fly  1723 NVTYGYTAANFSGRMPSVEVGDSVVSKGRETLERAIKLVE------NNEEWKVRVVYGDTDSMFV 1781
            |..||:|.|.. |::|.:|:..||.:.||..:|.....||      |..|....|:||||||:.|
  Fly   687 NSVYGFTGAQV-GKLPCLEISGSVTAYGRTMIEMTKNEVESHYTQANGYENNAVVIYGDTDSVMV 750

  Fly  1782 LVPGRNRAEAFRIGEEIAKAVTEMNPQPVKLKLEKVYQPCMLQTKKRYVGYMYETADQEQPVYEA 1846
            ....:....:..:|.|.|:.|:.....|:||:.||||.|.:|..||||.| :|.|........:.
  Fly   751 NFGVKTLERSMELGREAAELVSSKFVHPIKLEFEKVYYPYLLINKKRYAG-LYFTRPDTYDKMDC 814

  Fly  1847 KGIETVRRDGCPAVAKMLEKVLRILFETQDVSKIKAYVCRQFTKLLSGRANLQDLIFAKEFRGLN 1911
            |||||||||..|.||.::...|:.|...:|.....|||.:....||..|.::..|:..||....:
  Fly   815 KGIETVRRDNSPLVANLMNSCLQKLLIERDPDGAVAYVKQVIADLLCNRIDISHLVITKELAKTD 879

  Fly  1912 GYKPTACVPALELTRKWMQKDPRHVPRRGERVPFIIVNGPPGMQLIRLVRSPHDILANEGHKINA 1976
            .....|.|   ||..|..::||...|:.|:|||::|..........:....|..:|.| ...|:|
  Fly   880 YAAKQAHV---ELAAKMKKRDPGTAPKLGDRVPYVICAAAKNTPAYQKAEDPLYVLEN-SVPIDA 940

  Fly  1977 IYYITKAIIPPLNRCL-LLIGANVHDWFASLPRKLLMTPAVGTANELAGARGAKSTISQYFSTTS 2040
            .||:.:.:..||.|.. .::|.|..............|........|||....|         ||
  Fly   941 TYYLEQQLSKPLLRIFEPILGDNAESILLKGEHTRTRTVVTSKVGGLAGFMTKK---------TS 996

  Fly  2041 CVIDCGRQTKAG-----ICPDCLKNATTCVVVLSDKTARLERGYQLTRQICQACCGRL-GSLQCD 2099
            | :.|......|     :||.|....:............||..:......||.|...| ..:.|.
  Fly   997 C-LGCKSLMPKGYEQACLCPHCEPRMSELYQKEVGAKRELEETFSRLWTECQRCQESLHEEVICS 1060

  Fly  2100 SLDCPVLYVLEGKRRELQQIE 2120
            :.|||:.|:.:..|.:|...|
  Fly  1061 NRDCPIFYMRQKVRMDLDNQE 1081

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mus205NP_524881.2 GAT1 <754..989 CDD:227928
DNA_polB_zeta_exo 1297..1518 CDD:99821 65/291 (22%)
POLBc_zeta 1550..2000 CDD:99917 157/458 (34%)
DNA_pol_B 1550..1990 CDD:278562 154/447 (34%)
zf-C4pol 2041..2107 CDD:290959 16/71 (23%)
DNApol-deltaNP_524099.2 PTZ00166 48..1092 CDD:240301 271/996 (27%)
DNA_polB_delta_exo 288..517 CDD:99820 51/236 (22%)
POLBc_delta 564..960 CDD:99916 144/421 (34%)
zf-C4pol 997..1070 CDD:290959 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110637369
eggNOG 1 0.900 E1_COG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D20210at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.