DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus205 and Pold1

DIOPT Version :8

Sequence 1:NP_524881.2 Gene:mus205 / 47186 FlyBaseID:FBgn0002891 Length:2130 Species:Drosophila melanogaster
Sequence 2:NP_035261.3 Gene:Pold1 / 18971 MGIID:97741 Length:1105 Species:Mus musculus

Alignment Length:1169 Identity:288/1169 - (24%)
Similarity:476/1169 - (40%) Gaps:237/1169 - (20%)


  Fly  1086 LAMLQRHRGEQKVREYFSTQQRIAIEP----------AQLAPTWQEAKIWLKA-----KELLRQR 1135
            ||:|:....|.:::|   .::.:.:.|          |.:.|.|:...  |:|     :.|:.|:
Mouse    37 LALLEEIEAENRLQE---AEEELQLPPEGTVGGQFSTADIDPRWRRPT--LRALDPSTEPLIFQQ 96

  Fly  1136 EE----------------PKKSSDDIDSPIKIKRQKITMM------------------------- 1159
            .|                |.::|..|.....:..:..::.                         
Mouse    97 LEIDHYVGSAPPLPEGPLPSRNSVPILRAFGVTDEGFSVCCHIQGFAPYFYTPAPPGFGAEHLSE 161

  Fly  1160 LQAEEGDGGSGDEDAGEELDCSLSLTPLSQAKDKC-----------------KATPTSSKARETG 1207
            ||.|.....|.|:..|:||.     .|...|.:.|                 :.|....:.....
Mouse   162 LQQELNAAISRDQRGGKELS-----GPAVLAIELCSRESMFGYHGHGPSPFLRITLALPRLMAPA 221

  Fly  1208 KSRLKRGTRLSFIGSQDEEPPSSQSSEQSVS-----------SSAAQAELDRSSFLRQLEGSSQD 1261
            :..|::|.|:..:|:     ||....|.:|.           ......||....::|:.|..:..
Mouse   222 RRLLEQGVRVPGLGT-----PSFAPYEANVDFEIRFMVDADIVGCNWLELPAGKYVRRAEKKATL 281

  Fly  1262 RQHDLSFGLSHATLDNTFGFKVNLENLQQAKADIDCNHLTIITLEVFVSTRGDLQPDPMHDE-IR 1325
            .|.::....|........|....:..|:....||:|            :.|..:.|:|..|. |:
Mouse   282 CQLEVDVLWSDVISHPPEGQWQRIAPLRVLSFDIEC------------AGRKGIFPEPERDPVIQ 334

  Fly  1326 CLFYAIEHSLPDE----KLPSKACGYIMVNTVQDLLSEGPFHGIDRDIEVQVVTSEAEAFEALLA 1386
            .....:....|:.    .|..:.|..|:                  ..:||....|.:..:|...
Mouse   335 ICSLGLRWGEPEPFLRLALTLRPCAPIL------------------GAKVQSYEREEDLLQAWAD 381

  Fly  1387 LCERWDADIYAGYEIEMSSWGYVIDRAKHLCFNIAPLLSRVP--TQKVRDFVDEDREQFTDLDVE 1449
            .....|.|:..||.|:.....|:|.||:.|..:..|.|.||.  ...:||...:.|:........
Mouse   382 FILAMDPDVITGYNIQNFDLPYLISRAQALKVDRFPFLGRVTGLRSNIRDSSFQSRQVGRRDSKV 446

  Fly  1450 MKLCGRILLDVWRLMRSEIALTSYTFENVMYHIL--HKRCPWHTAKSLTE-WFGSPCTRWIVMEY 1511
            :.:.||:.:|:.:::..|..|.|||...|.:|.|  .|....|:.  :|: ..|:..||..:..|
Mouse   447 ISMVGRVQMDMLQVLLREHKLRSYTLNAVSFHFLGEQKEDVQHSI--ITDLQNGNEQTRRRLAVY 509

  Fly  1512 YLERVRGTLTLLDQLDLLGRTSEMAKLIGIQFYEVLSRGSQFRVESMMLRIAKPKNLVPLSPSVQ 1576
            .|:.....|.||::|.:|....|||::.|:....:|:||.|.:|.|.:||.|..:.|  |.|.|:
Mouse   510 CLKDAFLPLRLLERLMVLVNNVEMARVTGVPLGYLLTRGQQVKVVSQLLRQAMRQGL--LMPVVK 572

  Fly  1577 ARAHMRAPEYL-ALIMEPQSRFYADPLIVLDFQSLYPSMIIAYNYCFSTCL--GRVEHLGGSSPF 1638
            ...   :.:|. |.::||...:|..|:..|||.|||||:::|:|.|::|.|  |..:.||     
Mouse   573 TEG---SEDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLG----- 629

  Fly  1639 EFGASQLRVSRQMLQKLLEHDLVTVSPCGVVFVKREVREGILPRMLTEILDTRQMVKQSMKLHKD 1703
                             |:.|....:|.|..|||..||:|:||::|..:|..|:..|  .:|.::
Mouse   630 -----------------LKPDEFIKTPTGDEFVKSSVRKGLLPQILENLLSARKRAK--AELAQE 675

  Fly  1704 SSALQR-ILHSRQLGLKLMANVTYGYTAANFSGRMPSVEVGDSVVSKGRETLERAIKL------V 1761
            :..|:| :|..|||.||:.||..||:|.|.. |::|.:|:..||...||:.:|:..:|      |
Mouse   676 TDPLRRQVLDGRQLALKVSANSVYGFTGAQV-GKLPCLEISQSVTGFGRQMIEKTKQLVESKYTV 739

  Fly  1762 ENNEEWKVRVVYGDTDSMFVLVPGRNRAEAFRIGEEIAKAVTEMNPQPVKLKLEKVYQPCMLQTK 1826
            ||..:...:||||||||:.......:.|||..:|.|.|..|:...|.|::|:.||||.|.:|.:|
Mouse   740 ENGYDANAKVVYGDTDSVMCRFGVSSVAEAMSLGREAANWVSSHFPSPIRLEFEKVYFPYLLISK 804

  Fly  1827 KRYVGYMYETADQEQPVYEAKGIETVRRDGCPAVAKMLEKVLRILFETQDVSKIKAYVCRQFTKL 1891
            |||.|.::.:........:.||:|.||||.||.||.::...||.:...:|.....|:.....:.|
Mouse   805 KRYAGLLFSSRSDAHDKMDCKGLEAVRRDNCPLVANLVTSSLRRILVDRDPDGAVAHAKDVISDL 869

  Fly  1892 LSGRANLQDLIFAKE-------FRGLNGYKPTACVPALELTRKWMQKDPRHVPRRGERVPFIIVN 1949
            |..|.::..|:..||       :.|...:        :||..:..::||...|..|:|||::|:.
Mouse   870 LCNRIDISQLVITKELTRAAADYAGKQAH--------VELAERMRKRDPGSAPSLGDRVPYVIIG 926

  Fly  1950 GPPGMQLIRLVRSPHDILANEGHKINAIYYITKAIIPPLNR------------CLLLIGANVHDW 2002
            ...|:........|..:| .....|:..||:.:.:..||.|            .:||.|.:..  
Mouse   927 AAKGVAAYMKSEDPLFVL-EHSLPIDTQYYLEQQLAKPLLRIFEPILGEGRAESVLLRGDHTR-- 988

  Fly  2003 FASLPRKLLMTPAVGTANELAGARGAKSTISQYFSTTSCVIDCGR--QTKAGICPDCL-KNATTC 2064
                 .|.::|..||             .:..:....:|.|.|..  ..:..:|..|. :.:...
Mouse   989 -----CKTVLTSKVG-------------GLLAFTKRRNCCIGCRSVIDHQGAVCKFCQPRESELY 1035

  Fly  2065 VVVLSDKTARLERGYQLTRQICQACCGRL-GSLQCDSLDCPVLYVLEGKRRELQQIEHWNKLLE 2127
            ...:|...|..||..:|..| ||.|.|.| ..:.|.|.|||:.|:.:..|::|:..|   :||:
Mouse  1036 QKEVSHLNALEERFSRLWTQ-CQRCQGSLHEDVICTSRDCPIFYMRKKVRKDLEDQE---RLLQ 1095

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mus205NP_524881.2 GAT1 <754..989 CDD:227928
DNA_polB_zeta_exo 1297..1518 CDD:99821 50/230 (22%)
POLBc_zeta 1550..2000 CDD:99917 149/478 (31%)
DNA_pol_B 1550..1990 CDD:278562 145/456 (32%)
zf-C4pol 2041..2107 CDD:290959 21/69 (30%)
Pold1NP_035261.3 Nuclear localization signal. {ECO:0000255} 4..19
PTZ00166 78..1098 CDD:240301 279/1125 (25%)
DNA_polB_delta_exo 302..531 CDD:99820 58/260 (22%)
POLBc_delta 577..972 CDD:99916 135/428 (32%)
zf-C4pol 1010..1080 CDD:290959 21/70 (30%)
CysB motif 1056..1074 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.