DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus205 and Pola1

DIOPT Version :8

Sequence 1:NP_524881.2 Gene:mus205 / 47186 FlyBaseID:FBgn0002891 Length:2130 Species:Drosophila melanogaster
Sequence 2:NP_032918.1 Gene:Pola1 / 18968 MGIID:99660 Length:1465 Species:Mus musculus

Alignment Length:1571 Identity:307/1571 - (19%)
Similarity:537/1571 - (34%) Gaps:470/1571 - (29%)


  Fly   800 ENTKTSMNGTVALEKATKDSSSNSESPHQQENSVSEQIEYLES-------KPKKSDETA--RSCD 855
            |.:..|.:|:.|..:|.::..|        :....|.:|.|:.       |.:..|.|:  ...|
Mouse    12 EASAVSDSGSFAASRARREKKS--------KKGRQEALERLKKAKAGEKYKYEVEDLTSVYEEVD 68

  Fly   856 EKLQRELIP--QEPAGISPGDSANSTE---EITFSPCHDEAIE-----SDTES------DYIVTK 904
            |:...:|:.  |:...|...|.....|   ||......|:|::     ||.::      |.....
Mouse    69 EEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGKGSDGKAHRKDRKDVKKPS 133

  Fly   905 LRKTPNLKRL-----------------RWSIRSELLNKQFTPSSGIRPPETETTPQLSPKSNESN 952
            :.|..|:|.:                 :..:..::|....|.::.|.||     |.|.||...| 
Mouse   134 VTKPNNIKAMFIASAGKKTTDKAVDLSKDDLLGDILQDLNTETAQITPP-----PVLIPKKKRS- 192

  Fly   953 TPELMRSFYEHSLIVNSPSVFSDFLDSPEIHMDSPRSAPPSPD-SNSFVIAPLELPPSYDEVVSG 1016
            |..|:..|..|     :|...             |...|.||. .|..::.|:.|..:  |:...
Mouse   193 TGALLNPFSVH-----TPKAI-------------PSGKPASPVLRNEPLLTPIPLKRA--ELAGE 237

  Fly  1017 SRKMDIPE-------YEFQKPYYSNPSDVSKV-------------TEVGFLVLHIPGNKLNDCDP 1061
            ..:.:.||       .||:...:....|..||             ||....|.|       :.||
Mouse   238 LAQPECPEDEQELGVMEFEDGDFDESMDTEKVDEKPVTAKTWDQETEPVERVEH-------EADP 295

  Fly  1062 FQSILGNDRGLASWRRRQLIAIGGLAMLQRHRGEQKVREYFSTQQRIAIEPAQLAPT-------- 1118
                   :||..|:....|..:....:.|...         |..|.:.::.:.|...        
Mouse   296 -------ERGTTSYLENFLPDVSCWDIDQDDE---------SIPQEVQVDSSNLPLVKGADDEQV 344

  Fly  1119 ----WQEA---------------KIWLKAKE-------LLRQREE-----PKKSSDDIDS----- 1147
                |.:|               |:|:::.:       :::..|.     |::...|:::     
Mouse   345 FQFYWLDAYEDPYNQPGVVFLFGKVWIESVKTHVSCCVMVKNIERTLYFLPREMKFDLNTGKETA 409

  Fly  1148 -PIKIKRQKITMMLQAEEGDGGSGDEDAGEELDCSLSLTPLSQAKDKCKATPTSSKARETGKSRL 1211
             |:.:|                    |..||.|..:|.        |.|.....||..|.     
Mouse   410 IPVTMK--------------------DVYEEFDSKISA--------KYKIMKFKSKIVEK----- 441

  Fly  1212 KRGTRLSFIGSQDEEPPSSQSSEQSVSSSAAQAELDRSSFLRQLEGSSQDRQHDLSFGLSHATLD 1276
                  ::.....:.|..|:..|...|:...|..       :.|:|.:          .||....
Mouse   442 ------NYAFEIPDVPEKSEYLEVRYSAEVPQLP-------QNLKGET----------FSHVFGT 483

  Fly  1277 NTFGFK-------------VNLENLQQAKADIDCNHLTIITLEV-FVSTRGDLQPDPM------- 1320
            ||...:             :.::|.|.....|......::.|:. .|:...|:.|.|:       
Mouse   484 NTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEVMALKPDLVNVIKDVSPPPLVVMSFSM 548

  Fly  1321 ---------HDEIRCLFYAIEHSLPDEKLPSK---ACGYIMVNTVQDLLSEGPFHGI--DRDIEV 1371
                     ..||..:...:.||...:|.|.:   ...:.:|:..:|.:....|..:  .::::|
Mouse   549 KTMQNVQNHQHEIIAMAALVHHSFALDKAPPEPPFQTHFCVVSKPKDCIFPCDFKEVISKKNMKV 613

  Fly  1372 QVVTSEAEAFEALLALCERWDADIYAGYEIEMSSWGYVIDRAKHLC-FNIAPLLSRVPTQKVRDF 1435
            ::..:|.......||...:.|.||..|:.|               | |.:..||.|:...||..:
Mouse   614 EIAATERTLIGFFLAKVHKIDPDILVGHNI---------------CSFELEVLLQRINECKVPYW 663

  Fly  1436 VDEDREQFTDLDVEMKL------------CGRILLDVWRLMRSEIALTSYTFENVMYHILHKRCP 1488
            ....|.:.:::.   ||            |||::.||....:..|...||....::..||.....
Mouse   664 SKIGRLRRSNMP---KLGSRSGFGERNATCGRMICDVEISAKELIHCKSYHLSELVQQILKTERI 725

  Fly  1489 WHTAKSLTEWFGSPCTRWIVMEYYLERVRGTLTLLDQLDLLGRTSEMAKLIGIQFYEVLSRGSQF 1553
            ....:::...:........::|:..:..|..|.::.:|::|....::..:.|......|..|...
Mouse   726 VIPTENIRNMYSESSYLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSE 790

  Fly  1554 RVESMMLRIAKPKNLVPLSPSVQARAHMRAPEYL--------------------------ALIME 1592
            |.|.::|......|.:     |..:...|.|:..                          .|:::
Mouse   791 RNEFLLLHAFYENNYI-----VPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKATYAGGLVLD 850

  Fly  1593 PQSRFYADPLIVLDFQSLYPSMIIAYNYCFSTCLGRVEHLGGSSPFEFGASQLRVSRQMLQKLLE 1657
            |:..||...:::|||.|||||:|..:|.||:|.                   .||:.: :||..|
Mouse   851 PKVGFYDKFILLLDFNSLYPSIIQEFNICFTTV-------------------QRVTSE-VQKATE 895

  Fly  1658 HDLVTVSPCGVVFVKREVRE--------GILPRMLTEILDTRQMVKQSMKLHKDSSALQRILHSR 1714
            .:           .:.::.|        |||||.:.::::.|:.|||.||....:..|......|
Mouse   896 DE-----------EQEQIPELPDPNLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIR 949

  Fly  1715 QLGLKLMANVTYGYTAANFSGRMPSVEVGDSVVSKGRETLERAIKLVENNEEWKVRVVYGDTDSM 1779
            |..|||.||..||....::| |..:..:...|..||||.|.....:|   ::..:.|:||||||:
Mouse   950 QKALKLTANSMYGCLGFSYS-RFYAKPLAALVTYKGREILMHTKDMV---QKMNLEVIYGDTDSI 1010

  Fly  1780 FVLVPGRNRAEAFRIGEEIAKAVTEMNPQPVKLKLEKVYQPCMLQTKKRYVGYMYETADQEQPV- 1843
            .:.....|..|.|::|.::...|.::. :.:::.::.|::..:|..||:|...:.|.......: 
Mouse  1011 MINTNSTNLEEVFKLGNKVKSEVNKLY-KLLEIDIDAVFKSLLLLKKKKYAALVVEPTSDGNYIT 1074

  Fly  1844 -YEAKGIETVRRDGCPAVAKMLEKVLRILFETQDVSKIKA-YVCRQFTKLLSGRA------NLQD 1900
             .|.||::.||||.|                  |::|... :|..|   :||.::      |:|.
Mouse  1075 KQELKGLDIVRRDWC------------------DLAKDTGNFVIGQ---ILSDQSRDTIVENIQK 1118

  Fly  1901 LIFAKEFRGLNGYKPTACVPALELTRKWMQKDPRHVPRR----------------------GERV 1943
            .:.......|||..|   |...|: .|.:.|||:..|.|                      |:.|
Mouse  1119 RLIEIGENVLNGSVP---VSQFEI-NKALTKDPQDYPDRKSLPHVHVALWINSQGGRKVKAGDTV 1179

  Fly  1944 PFIIVNGPPGMQLIRLVRSPHDILANEGHKINAIYYITKAIIPPLNR-C-----------LLLIG 1996
            .::|......:...:...:|..:...:...|:..||:.:.|.|.:.| |           .|.:|
Mouse  1180 SYVICQDGSNLTATQRAYAPEQLQKLDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLG 1244

  Fly  1997 AN-----VHDWFASLPR-KLLMTPAVGTANE----------LAGARGAKSTISQYFSTTSCVIDC 2045
            .:     ||.:...... .||..||..|..|          |..:.|.::.....|..:...::.
Mouse  1245 LDSTQFRVHQYHKDEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGLDMEP 1309

  Fly  2046 GRQTKAGICPDCLKNATTCVVVLSDK----TARLERGYQLTRQICQ--ACCGRL----------G 2094
            .....:.:  ||..:..|.:|.||:|    ..|..:.|.....||:  .||.||          |
Mouse  1310 SLYRCSNV--DCKVSPLTFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCCSRLRRLPLHFSRNG 1372

  Fly  2095 SLQCDSLDCPV 2105
            .|      |||
Mouse  1373 PL------CPV 1377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mus205NP_524881.2 GAT1 <754..989 CDD:227928 45/230 (20%)
DNA_polB_zeta_exo 1297..1518 CDD:99821 44/255 (17%)
POLBc_zeta 1550..2000 CDD:99917 120/531 (23%)
DNA_pol_B 1550..1990 CDD:278562 116/504 (23%)
zf-C4pol 2041..2107 CDD:290959 20/81 (25%)
Pola1NP_032918.1 DNA_pol_alpha_N 41..101 CDD:289058 13/59 (22%)
pol2 56..1229 CDD:273159 263/1361 (19%)
DNA_polB_alpha_exo 539..771 CDD:99819 44/249 (18%)
DNA-binding region. {ECO:0000255} 654..719 14/67 (21%)
POLBc_alpha 836..1246 CDD:99915 112/470 (24%)
DNA-binding region. {ECO:0000255} 1249..1380 31/137 (23%)
zf-DNA_Pol 1269..1458 CDD:286132 26/117 (22%)
CysB motif 1352..1378 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.