DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Men and NADP-ME3

DIOPT Version :8

Sequence 1:NP_524880.2 Gene:Men / 47173 FlyBaseID:FBgn0002719 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_197960.1 Gene:NADP-ME3 / 832657 AraportID:AT5G25880 Length:588 Species:Arabidopsis thaliana

Alignment Length:599 Identity:291/600 (49%)
Similarity:394/600 (66%) Gaps:39/600 (7%)


  Fly   177 TSETNLEDKMSKPDSKLDKYAQRDRLGLWGTGDNEVVGS----------------LSGFTRLLDK 225
            |::|.:.          |:|...:..|: |.|.::|.|.                .||:|.:.|.
plant     3 TNQTQIS----------DEYVTGNSSGV-GGGISDVYGEDSATLDQLVTPWVTSVASGYTLMRDP 56

  Fly   226 RYSKGLAFTHEERQQLGIHGMLPYVVREPSEQVEHCRALLARLDQ---DLDKYMYLISLSERNER 287
            ||:||||||.:||....|.|:||.||.  |:.|:. |.::..|.|   .|.:||.|:.|.|||||
plant    57 RYNKGLAFTDKERDAHYITGLLPPVVL--SQDVQE-RKVMHNLRQYTVPLQRYMALMDLQERNER 118

  Fly   288 LFYNVLSSDIAYMMPLVYTPTVGLACQRYSLIHQNAKGMFISIKDKGHIYDVLKNWPETDVRAIV 352
            |||.:|..::..::|:|||||||.|||:|..|::..:|::||:|:||.|.:||||||:..::.||
plant   119 LFYKLLIDNVEELLPVVYTPTVGEACQKYGSIYRRPQGLYISLKEKGKILEVLKNWPQRGIQVIV 183

  Fly   353 VTDGERILGLGDLGANGMGIPVGKLSLYTALAGIKPSQCLPITLDVGTNTESILEDPLYIGLRER 417
            ||||||||||||||..|||||||||||||||.||:||.|||||:|||||.|.:|.:..||||:::
plant   184 VTDGERILGLGDLGCQGMGIPVGKLSLYTALGGIRPSACLPITIDVGTNNEKLLNNEFYIGLKQK 248

  Fly   418 RATGDLYDEFIDEFMHACVRRFGQNCLIQFEDFANANAFRLLSKYRDSFCTFNDDIQGTASVAVA 482
            ||.|:.|.||:.|||.|..:.:|:..|:|||||||.:||.|||||..|...|||||||||||.:|
plant   249 RANGEEYAEFLQEFMCAVKQNYGEKVLVQFEDFANHHAFELLSKYCSSHLVFNDDIQGTASVVLA 313

  Fly   483 GLLASLKIKKTQLKDNTLLFLGAGEAALGIANLCLMAMKVE---GLTEEEAKARIWMVDSRGVIT 544
            ||:|:.|:....|.|:|.||||||||..|||.  |:|:|:.   |...:|.:.:||:|||:|:|.
plant   314 GLIAAQKVLGKSLADHTFLFLGAGEAGTGIAE--LIALKISKETGKPIDETRKKIWLVDSKGLIV 376

  Fly   545 RDRPKGGLTEHKLHFAQLHEPIDTLAEAVRKVRPNVLIGAAAQGGAFNQEILELMADINETPIIF 609
            .:| |..|...|..:|..|:|:..|..||..::|.||||.:..|..|.:|::|.||.:||.|:|.
plant   377 SER-KESLQHFKQPWAHDHKPVKELLAAVNAIKPTVLIGTSGVGKTFTKEVVEAMATLNEKPLIL 440

  Fly   610 ALSNPTSKAECTAEEAYTYTKGRCIFASGSPFAPVTYNNKKFYPGQGNNSYIFPGVALGVLCAGM 674
            |||||||:||||||||||:||||.||||||||.||.|:.|||.|||.||.|||||:.||::.:|.
plant   441 ALSNPTSQAECTAEEAYTWTKGRAIFASGSPFDPVQYDGKKFTPGQANNCYIFPGLGLGLIMSGA 505

  Fly   675 LNIPEQVFLVAAERLAELVSKDDLAKGSLYPPLSSIVSCSMAIAERIVEYAYKNGLATVRPEPVN 739
            :.:.:.:.|.|:|.||..|::::.|.|.:|||.::|...|..||..:....|:.|||:..|.|.:
plant   506 IRVRDDMLLAASEALASQVTEENFANGLIYPPFANIRKISANIAASVGAKTYELGLASNLPRPKD 570

  Fly   740 KLAFIKAQMYDLDY 753
            .:...::.||...|
plant   571 LVKMAESCMYSPVY 584

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MenNP_524880.2 PLN03129 213..757 CDD:215594 283/564 (50%)
malic 282..463 CDD:278802 112/181 (62%)
NAD_bind_1_malic_enz 473..750 CDD:133454 134/280 (48%)
NADP-ME3NP_197960.1 PLN03129 20..588 CDD:215594 286/573 (50%)
malic 113..293 CDD:278802 111/180 (62%)
NAD_bind_1_malic_enz 304..582 CDD:133454 134/281 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 559 1.000 Inparanoid score I242
OMA 1 1.010
OrthoDB 1 1.010 D435571at2759
OrthoInspector 1 1.000 T32113
orthoMCL 1 0.900 OOG5_126753
Panther 1 1.100 O PTHR23406
Phylome 1 0.910 0.935 Consistency score
87.980

Return to query results.
Submit another query.