DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Men and CG7848

DIOPT Version :8

Sequence 1:NP_524880.2 Gene:Men / 47173 FlyBaseID:FBgn0002719 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_611127.1 Gene:CG7848 / 36839 FlyBaseID:FBgn0034127 Length:633 Species:Drosophila melanogaster

Alignment Length:606 Identity:236/607 (39%)
Similarity:350/607 (58%) Gaps:23/607 (4%)


  Fly   163 QQQQQQQQLRSYSSTSETNLEDKMSKPDSKLDKYAQRDRLGLWGTGDNEVVGS-LSGFTRLLDKR 226
            ::.|:.::|:..|:..:|.:.|.|.:   .:|.:        |.. |..:.|| :.|...|....
  Fly    28 EELQKNKELKCVSNYDKTEILDYMPR---YMDTF--------WKM-DTRLSGSKVDGLWMLNQSN 80

  Fly   227 YSKGLAFTHEERQQLGIHGMLPYVVREPSEQVEHCRALLARLDQDLDKYMYLISLSERNERLFYN 291
            |:||||||..||:.|.|||:||..||...||.|.|..||.....::.:|:||..||.||.||||.
  Fly    81 YNKGLAFTLNERRVLSIHGLLPVAVRTIDEQAEICSNLLESFTNNVQQYIYLTYLSRRNRRLFYY 145

  Fly   292 VLSSDIAYMMPLVYTPTVG----LACQRYSLIHQNAKGMFISIKDKGHIYDVLKNWPETDVRAIV 352
            :|.|:....:|:  |...|    |...|  :||...:|::|.|||.||:..:|.|||...||.::
  Fly   146 LLLSNPDRFVPM--TDASGSIDLLMVHR--MIHSMGQGLYICIKDLGHVSQILSNWPFRCVRCLL 206

  Fly   353 VTDGERILGLGDLGANGMGIPVGKLSLYTALAGIKPSQCLPITLDVGTNTESILEDPLYIGLRER 417
            |::|..:|.:||||.:.|.|....|.......||.|:.||.:.||||||.|.:|.||:|.|||||
  Fly   207 VSNGASVLSVGDLGVDEMPILFSNLHQNVVYGGIHPAYCLAVMLDVGTNNEELLNDPMYTGLRER 271

  Fly   418 RATGDLYDEFIDEFMHACVRRFGQNCLIQFEDFANANAFRLLSKYRDSFCTFNDDIQGTASVAVA 482
            |.:..|||:..:||..:.::::|...||..:||....|.:.|..||:..|..:.|.|..|:||:|
  Fly   272 RCSEKLYDQLFEEFTLSVMQQYGPRALILCKDFEAQKAKKQLELYRERQCIVDVDFQCFAAVALA 336

  Fly   483 GLLASLKIKKTQLKDNTLLFLGAGEAALGIANLCLMAMKVEGLTEEEAKARIWMVDSRGVITRDR 547
            |::...::|:.....|..||.||....:|:|.||::.:|.|||.|.:|:.:||..|:.|::...|
  Fly   337 GVIVCNRLKRVFFSSNVFLFYGAEAINIGMARLCMVLLKREGLIEMKAREKIWFFDANGLVVLGR 401

  Fly   548 PKGGLTEHKLHFAQLHEPIDTLAEAVRKVRPNVLIGAAAQGGAFNQEILELMADINETPIIFALS 612
            .  .:.|..|.||...:||..|.||:::::||:|:|.::....|..::|..|....:.|:|||||
  Fly   402 K--DIPEELLEFANQRDPILDLVEAIQELKPNILVGGSSLPNTFTPDVLRAMEKSADQPVIFALS 464

  Fly   613 NPTSKAECTAEEAYTYTKGRCIFASGSPFAPVTYNNKKFYPGQGNNSYIFPGVALGVLCAGMLNI 677
            .|..:.||:||:|::||||.|||.|||...|:.|.||.:.||...:||:..|::.||:.||..||
  Fly   465 RPLEQTECSAEDAFSYTKGHCIFISGSKLPPLKYANKWYQPGHCTSSYLVAGISCGVMLAGFTNI 529

  Fly   678 PEQVFLVAAERLAELVSKDDLAKGSLYPPLSSIVSCSMAIAERIVEYAYKNGLATVRPEPVNKLA 742
            |::.|.|||||||.||...||.|.::|||:..|...|:.|||.|..||:..||||:.|:|.|.:.
  Fly   530 PDEAFCVAAERLASLVWPCDLEKRNVYPPMRKIQCISLQIAEAIFSYAFGRGLATLYPQPENPME 594

  Fly   743 FIKAQMYDLDYPRSVPATYKM 763
            :||..||:.:|..::...|.|
  Fly   595 YIKNSMYNPEYRMNIVDVYCM 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MenNP_524880.2 PLN03129 213..757 CDD:215594 225/549 (41%)
malic 282..463 CDD:278802 74/185 (40%)
NAD_bind_1_malic_enz 473..750 CDD:133454 116/277 (42%)
CG7848NP_611127.1 PLN03129 81..606 CDD:215594 221/531 (42%)
malic 138..317 CDD:278802 73/183 (40%)
NAD_bind_1_malic_enz 327..603 CDD:133454 116/278 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31444675
eggNOG 1 0.900 E1_COG0281
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 332 1.000 Inparanoid score I418
Isobase 1 0.950 0 Normalized mean entropy S996
OrthoDB 1 1.010 D435571at2759
OrthoFinder 1 1.000 FOG0000430
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23406
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.