DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Men and SPAC750.08c

DIOPT Version :8

Sequence 1:NP_524880.2 Gene:Men / 47173 FlyBaseID:FBgn0002719 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_595034.1 Gene:SPAC750.08c / 2542710 PomBaseID:SPAC750.08c Length:228 Species:Schizosaccharomyces pombe

Alignment Length:174 Identity:53/175 (30%)
Similarity:88/175 (50%) Gaps:18/175 (10%)


  Fly   569 LAEAVRKVRPNVLIGAAAQGGAFNQEILELMADINETPIIFALSNPTSKAECTAEEAYTYTKGRC 633
            |..|:..::|.||:|.:.|.|.|.::.:..|:...:.||||.:||||:..|....:...::.|:.
pombe    38 LETAISLIKPTVLLGCSGQPGKFTEKAIREMSKHVKHPIIFPISNPTTLMEAKPVQIDEWSNGKA 102

  Fly   634 IFASGSPFAPVTYNNKKFYPGQGNNSYIFPGVALGVLCA---------GMLNIPEQVFLVAAERL 689
            :.|:|||..|:|.|.|::...|.||:.::|  ||||.|.         |||.       .|::.|
pombe   103 LMATGSPLPPLTRNGKEYVISQCNNALLYP--ALGVACVLSRCKLLSDGMLK-------AASDAL 158

  Fly   690 AELVSKDDLAKGSLYPPLSSIVSCSMAIAERIVEYAYKNGLATV 733
            |.:.....:|..:|.|.|.:....|..|...:::.|...|::||
pombe   159 ATVPRSLFVADEALLPDLDNAREISRHIVFAVLKQAISEGMSTV 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MenNP_524880.2 PLN03129 213..757 CDD:215594 53/175 (30%)
malic 282..463 CDD:278802
NAD_bind_1_malic_enz 473..750 CDD:133454 53/175 (30%)
SPAC750.08cNP_595034.1 NADB_Rossmann <1..222 CDD:304358 53/175 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000430
OrthoInspector 1 1.000 T133308
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.