DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adf1 and CG8119

Sequence 1:NP_001260730.1 Gene:Adf1 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster

Alignment Length:261 Identity:52/262 (20%)
Similarity:101/262 (39%) Gaps:51/262 (19%)


  Fly     7 NLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQ---TWKQIAETLGVPEQKCTKRWKSLRDK 68
            |||..   :|:..:.|.|.|:|.   ..|..:|:.|   .|..::..:|:...:|.:||||||:.
  Fly    12 NLETN---HLLREIALRPSIWDS---RIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNN 70

  Fly    69 FAREMKLCQESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIF 133
            :..::.......|.:.|||:|:.|....::.....:|....:.:..:..|.|..|:     |..:
  Fly    71 YRTKIHQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQYLQS-----VASY 130

  Fly   134 AQPFNGSATTSAQ----ALTHPHEITVTSDAQLATAVGKDQ-----------KPYFYEPPLKRER 183
            :....|.....|:    .:|......:..|.::...:|.||           .|.|..||     
  Fly   131 SAFKKGGIEFEAEERLFLVTDEPAFDLDVDEEVTRLLGTDQWLWQTNLDFILLPIFRAPP----- 190

  Fly   184 SEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLA 248
                            .:.:::..:..::.|.:.:..||.:|..|.|...:....:.|.:| |:|
  Fly   191 ----------------PSAMAKISNESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLREM-LIA 238

  Fly   249 Q 249
            :
  Fly   239 E 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 23/83 (28%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 23/83 (28%)
BESS 201..234 CDD:281011 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.