DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCK1 and CG8907

DIOPT Version :9

Sequence 1:NP_001278928.1 Gene:NCK1 / 4690 HGNCID:7664 Length:377 Species:Homo sapiens
Sequence 2:NP_001247146.1 Gene:CG8907 / 42050 FlyBaseID:FBgn0038466 Length:732 Species:Drosophila melanogaster


Alignment Length:207 Identity:39/207 - (18%)
Similarity:77/207 - (37%) Gaps:71/207 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    11 FDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN-----------SARK 64
            |:..|..::||.:.|.|.|.::|||::||:.|||....|:||...:...|           |...
  Fly   444 FNKSATNDKELKVTKGEYLEIIDDSRNWWKARNSYGNIGYVPHTVLTPYNFEPGVNGRDTESLAS 508

Human    65 ASIVKN----------LKDTLGI-----------GKVKRK----PSVP---------DSASPADD 95
            .::.:|          .::|:.:           ||..::    |:||         ||.:|...
  Fly   509 MALTENGGEEAIPPPLYRNTMAMYTAPVEQPAANGKAMQRTFSMPNVPVPPPMPPPSDSQTPTPS 573

Human    96 SFV-------------------DPGERLYDLNMPAYVKFNYM---AEREDELSLIKGTKVIVMEK 138
            ..:                   :..::||.:....:.:...:   .||..:|.::|..::.:.:.
  Fly   574 GTLKRNMAAAGALAAMRARNDCEADDQLYYMQGDVHDELRLLQQQRERRKDLEILKTPEIFITQN 638

Human   139 CS----DGWWRG 146
            ..    :.|.||
  Fly   639 SKPSEVEEWLRG 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCK1NP_001278928.1 SH3_Nck1_1 3..61 CDD:212833 19/60 (32%)
SH3_Nck1_2 108..162 CDD:212834 7/46 (15%)
SH3_Nck1_3 193..249 CDD:212837
SH2_Nck1 280..376 CDD:198271
CG8907NP_001247146.1 PTB_EPS8 43..175 CDD:269921
SH3_Eps8 439..492 CDD:212698 18/47 (38%)
SAM_superfamily 635..699 CDD:301707 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.