DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCK1 and Stam

DIOPT Version :9

Sequence 1:NP_001278928.1 Gene:NCK1 / 4690 HGNCID:7664 Length:377 Species:Homo sapiens
Sequence 2:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster


Alignment Length:260 Identity:63/260 - (24%)
Similarity:102/260 - (39%) Gaps:76/260 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAEEVVVVAKF-DYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARK 64
            :||:...:.|. :.|:.|::|.||.|...|.|.::..|        .|||.|.        |...
  Fly   155 VAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKENKGS--------PKTGSVA--------STGT 203

Human    65 ASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVK--FNYMAEREDELSL 127
            ||...:|..:.. |.....||...|::||.:              |..|:  :::.|..|:||:.
  Fly   204 ASAYPSLYPSFA-GTGSSAPSAEASSAPAPE--------------PRKVRALYDFEAAEENELTF 253

Human   128 IKGTKVIVMEKCSDGWWRGSYN--GQVGWFPSNYVTEE--------------------GDSPLGD 170
            ..|..:.|::.....||:| ||  |: |.||||:||.:                    |...| |
  Fly   254 FAGEIIHVLDDSDPNWWKG-YNQRGE-GLFPSNFVTADLSVDPERLDINQQHKSAAAAGQREL-D 315

Human   171 HVGSLSEKLAAV----------VNNLNTGQVLHVVQALYPF--SSSNDEELNFEK-----GDVMD 218
            ...:|.:|..|.          ::.....::||::....|.  |..:||.|..|:     |.::|
  Fly   316 SAAALQQKTEAAAAAAAAQPVEIDESKIDRLLHLLHEANPEDPSQDSDEMLQLEQEVHQMGPLID 380

Human   219  218
              Fly   381  380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCK1NP_001278928.1 SH3_Nck1_1 3..61 CDD:212833 15/58 (26%)
SH3_Nck1_2 108..162 CDD:212834 20/57 (35%)
SH3_Nck1_3 193..249 CDD:212837 9/33 (27%)
SH2_Nck1 280..376 CDD:198271
StamNP_477448.1 VHS_STAM 10..154 CDD:239625
SH3_STAM 235..288 CDD:212754 19/54 (35%)
GAT 340..412 CDD:281166 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.