DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NCK1 and aru

DIOPT Version :9

Sequence 1:	NP_001278928.1	Gene:	NCK1 / 4690	HGNCID:	7664	Length:	377	Species:	Homo sapiens
Sequence 2:	NP_722663.1	Gene:	aru / 33268	FlyBaseID:	FBgn0029095	Length:	805	Species:	Drosophila melanogaster

Alignment Length:	132	Identity:	33/132 - (25%)
Similarity:	53/132 - (40%)	Gaps:	43/132 - (32%)

- Green bases have known domain annotations that are detailed below.

Human   185 NLNTGQVLH------------VVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKING 237
            |::..|:|.            :|...||.:::||:||:..:|:.::::   ::..:|||.|.:.|
  Fly   670 NVSDDQMLESWLEDLQATGAKIVLVTYPRTANNDKELSVMRGEYLEIL---DDTRKWWKARNMRG 731

Human   238 MVGLVPKNYVTV-------------MQNNPLT----------SGLEP-----SPPQCDYIRPSLT 274
            .|..||...||.             .|..|.|          ||..|     ||...|.:|....
  Fly   732 QVAHVPHTIVTPFNFGDGDGAQFYGQQQQPPTGPTGPGNKSRSGDNPGMEQRSPDPTDMMRSKHL 796

Human   275 GK 276
            ||
  Fly   797 GK 798

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NCK1	NP_001278928.1	SH3_Nck1_1	3..61	CDD:212833
		SH3_Nck1_2	108..162	CDD:212834
		SH3_Nck1_3	193..249	CDD:212837	17/67 (25%)
		SH2_Nck1	280..376	CDD:198271
aru	NP_722663.1	PTB_EPS8	82..215	CDD:269921
aru	NP_722663.1	SH3_Eps8	691..744	CDD:212698	18/55 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910