DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCK1 and Socs16D

DIOPT Version :9

Sequence 1:NP_001278928.1 Gene:NCK1 / 4690 HGNCID:7664 Length:377 Species:Homo sapiens
Sequence 2:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster


Alignment Length:401 Identity:78/401 - (19%)
Similarity:138/401 - (34%) Gaps:101/401 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    26 NERLWLL--DDSKSWWRVRNSMNKT---GFVPSNYVERKNSARKAS-----------------IV 68
            ||.:|.:  :.:.:..|.|:|:..|   |..|.    ..|.|..||                 :.
  Fly   587 NETIWSVSTNTTTTTARTRSSVGTTRGGGGPPG----AGNGAGGASSDGGVGGGSAGGGGGKYLS 647

Human    69 KNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSL---IKG 130
            |..|..|...|:....:..::..|:......|....::.:.|...|....:|::.:.:|   .:.
  Fly   648 KQNKHNLDNDKLNNNNNNNNNHQPSQQQLEKPPTEHHNQHQPPNNKHVLHSEKKSQFTLNLKQRF 712

Human   131 TKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSE--------KLAAVVNNLN 187
            ..:....:.:....|||.|.|.|.|.|........:||...:..::.        :||:.:|.  
  Fly   713 CSIFRFRRSNHSRCRGSGNNQTGTFASANANAAATAPLIPPIAVITSAPGAAGQTQLASELNG-- 775

Human   188 TGQVLHVVQALYPFSSSNDEELNFEKGDVMDV-------------IEKPENDPEWWKCRKINGMV 239
               .|...:|..|   :.|....|:...:..:             ||..:::||..|...|....
  Fly   776 ---TLITAEADEP---NADLRKKFQSRALPPLPKKALPFTAAAYAIEAVKSEPEEVKTNAIQEPR 834

Human   240 GLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGD 304
            .|            ..||.:|               |.....||:|.::...||..|:.. .:|.
  Fly   835 AL------------QFTSSIE---------------KVKDYGWYWGPLSSEAAEKVLSSE-PDGS 871

Human   305 FLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQ-RKFST------MEELVEHYKKAPIF 362
            |::|||......||:|.|.....:|.:::..:..:..|. .||.:      :|:.|||       
  Fly   872 FIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQTITEFIEKAVEH------- 929

Human   363 TSEQGEKLYLV 373
             |..|..|:.:
  Fly   930 -SRSGRYLFFL 939

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCK1NP_001278928.1 SH3_Nck1_1 3..61 CDD:212833 9/39 (23%)
SH3_Nck1_2 108..162 CDD:212834 12/56 (21%)
SH3_Nck1_3 193..249 CDD:212837 11/68 (16%)
SH2_Nck1 280..376 CDD:198271 26/101 (26%)
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 29/121 (24%)
SOCS_SOCS7 960..1009 CDD:239710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.