DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NCK1 and sl

DIOPT Version :9

Sequence 1:	NP_001278928.1	Gene:	NCK1 / 4690	HGNCID:	7664	Length:	377	Species:	Homo sapiens
Sequence 2:	NP_476726.2	Gene:	sl / 32601	FlyBaseID:	FBgn0003416	Length:	1236	Species:	Drosophila melanogaster

Alignment Length:	103	Identity:	30/103 - (29%)
Similarity:	47/103 - (45%)	Gaps:	10/103 - (9%)

- Green bases have known domain annotations that are detailed below.

Human   260 EPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQ 324
            ||.|      :|.   |.....|::...|:.|||..| .|...|.||:|.|..|.|.|.:|....
  Fly   688 EPVP------QPK---KHEDQEWFHPNTTKEQAEQGL-YRLEIGSFLVRPSVQSINAFVISFTIN 742

Human   325 GKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIF 362
            .|.||.::..:..:|.|....|.::..|:.:|.:.|::
  Fly   743 RKIKHCRIMQEGRLYGIDTMNFESLVSLINYYTRNPLY 780

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NCK1	NP_001278928.1	SH3_Nck1_1	3..61	CDD:212833
		SH3_Nck1_2	108..162	CDD:212834
		SH3_Nck1_3	193..249	CDD:212837
		SH2_Nck1	280..376	CDD:198271	25/83 (30%)
sl	NP_476726.2	PH_PLC_gamma	22..147	CDD:270168
		PI-PLCc_gamma	323..>470	CDD:176534
		SH2_N-SH2_PLC_gamma_like	584..682	CDD:199829
		SH2_C-SH2_PLC_gamma_like	696..796	CDD:198186	25/86 (29%)
		SH3_PLCgamma	828..880	CDD:212759
		PLCYc	981..1091	CDD:128454
		C2_PLC_like	1109..1215	CDD:175974
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910