DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and CAR1

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_015214.1 Gene:CAR1 SGDID:S000006032 Length:333 Species:Saccharomyces cerevisiae

Alignment Length:336 Identity:116/337 (34%)
Similarity:176/337 (52%) Gaps:51/337 (15%)


  Fly    30 QSLGIIGVPFAKGQAKQGVELAPDLLRQSSLRQVLQSSHDGLVIRDYG---NLQYAVDEP----L 87
            :.|.|:..||:.||.|.|||..|..:    |:..||:|     |.|.|   .|:.::||.    .
Yeast    13 RELSIVLAPFSGGQGKLGVEKGPKYM----LKHGLQTS-----IEDLGWSTELEPSMDEAQFVGK 68

  Fly    88 LQQQR--------VHYHHIR-NYADFMACNRALIEQVKLMLVENTQF-LAIGGDHAIGFGSVAGH 142
            |:.::        |....:: ..||.:.....|:......:|:..:| |.:||||:|..|:|:..
Yeast    69 LKMEKDSTTGGSSVMIDGVKAKRADLVGEATKLVYNSVSKVVQANRFPLTLGGDHSIAIGTVSAV 133

  Fly   143 LQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQLRNTWQHAGLQEIAPNC-------- 199
            |...|:..|:|||||||||...::.|||:||.|||||:          ||.:..|:|        
Yeast   134 LDKYPDAGLLWIDAHADINTIESTPSGNLHGCPVSFLM----------GLNKDVPHCPESLKWVP 188

  Fly   200 --LPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDALNPQNK----IHV 258
              |...::.||||||:|..|..||..:||..::|..:|:.|:..:|||.:.|::|:..    |..
Yeast   189 GNLSPKKIAYIGLRDVDAGEKKILKDLGIAAFSMYHVDKYGINAVIEMAMKAVHPETNGEGPIMC 253

  Fly   259 SFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLG-SERDVRTTVE 322
            |:|:|.:|....|:|||.||||||||||:.:||.|.::..:..:|:||.||.|. .:..|..|:.
Yeast   254 SYDVDGVDPLYIPATGTPVRGGLTLREGLFLVERLAESGNLIALDVVECNPDLAIHDIHVSNTIS 318

  Fly   323 SGLEILKSMFG 333
            :|..|.:...|
Yeast   319 AGCAIARCALG 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 115/331 (35%)
CAR1NP_015214.1 rocF_arginase 16..333 CDD:162262 115/334 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21835293
eggNOG 1 0.900 E1_COG0010
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I1027
Isobase 1 0.950 0 Normalized mean entropy S1415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001514
OrthoInspector 1 1.000 T1135637
orthoMCL 1 0.900 OOG5_128245
Panther 1 1.100 LDO PTHR43782
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R79
TreeFam 1 0.960
1211.730

Return to query results.
Submit another query.