DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and ARGAH1

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_192629.1 Gene:ARGAH1 AraportID:AT4G08900 Length:342 Species:Arabidopsis thaliana

Alignment Length:316 Identity:74/317 (23%)
Similarity:124/317 (39%) Gaps:81/317 (26%)


  Fly    31 SLGIIGVPFAKGQA-KQGVELAPDLLRQ-------SSLRQVLQSSHDGLVIRDYGNL------QY 81
            |..::|||.....: .||...||..:|:       :|..:..:...|..|:.|.|::      ..
plant    64 STSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELKDPRVLTDVGDVPVQEIRDC 128

  Fly    82 AVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLVEN-TQFLAIGGDHAIGFGSVAGHLQH 145
            .||:..|.                   ..:.|.|||::.|. .:.|.:||||:|.:..|....:.
plant   129 GVDDDRLM-------------------NVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEK 174

  Fly   146 TPN-LSLVWIDAHADI------NLHSTSQSGNIHGMPVSFLLEQLRNTWQHAGLQEIAPNCLPKD 203
            ... :.::.:|||.||      |.:|       |....:.::|        .|...         
plant   175 LGGPVDILHLDAHPDIYDCFEGNKYS-------HASSFARIME--------GGYAR--------- 215

  Fly   204 QLVYIGLRDIDPYEAFILNKVGIRYYAMDTI--DRVGVPKIIEMTLDALNPQNKIHVSFDIDALD 266
            :|:.:|:|.|:........:.|:..|.|.|.  ||   |.:..:.|.  .....:::|.|:|.||
plant   216 RLLQVGIRSINQEGREQGKRFGVEQYEMRTFSKDR---PMLENLKLG--EGVKGVYISIDVDCLD 275

  Fly   267 SNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLGSERDVRTTVE 322
            ...||.......|||:.|:.::|:..|:  ..|.|.|:||.||:       |.||:
plant   276 PAFAPGVSHIEPGGLSFRDVLNILHNLQ--ADVVGADVVEFNPQ-------RDTVD 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 73/316 (23%)
ARGAH1NP_192629.1 PLN02615 2..342 CDD:178224 74/317 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2545
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T193203
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.957 Consistency score
43.960

Return to query results.
Submit another query.