DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and arg2

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001072685.1 Gene:arg2 XenbaseID:XB-GENE-482624 Length:360 Species:Xenopus tropicalis

Alignment Length:327 Identity:133/328 (41%)
Similarity:191/328 (58%) Gaps:27/328 (8%)


  Fly    31 SLGIIGVPFAKGQAKQGVELAPDLLRQSSLRQVLQSSHDGLVIRDYGNLQYA-VDEPLLQQQRVH 94
            |:.:||.||:|||.::|||..|..:|.:.|  :.:.|:.|..:.|:|:|.:: |....|....| 
 Frog    27 SVAVIGAPFSKGQKRRGVEHGPAAIRSAGL--IDRLSNLGCNVCDFGDLHFSQVPNDELYNSIV- 88

  Fly    95 YHHIRNYADFMACNRALIEQVKLMLVENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHAD 159
             .|.|...  :|| :.|.|:|...:......:.:||||::.|||:.||.|..|:|.::|:|||||
 Frog    89 -KHPRTVG--LAC-KVLAEEVSKAVGAGHTCVTLGGDHSLAFGSITGHAQQCPDLCVIWVDAHAD 149

  Fly   160 INLHSTSQSGNIHGMPVSFLLEQLRN--------TWQHAGLQEIAPNCLPKDQLVYIGLRDIDPY 216
            ||...|:.|||:||.||||||.:|::        :|        |..||.|..:|||||||:||.
 Frog   150 INTPLTTPSGNLHGQPVSFLLRELQDKVPPIPGFSW--------AKPCLSKSDIVYIGLRDLDPA 206

  Fly   217 EAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDAL--NPQNKIHVSFDIDALDSNVAPSTGTAVRG 279
            |.|||....|.||:|..||.:|:.|::|.|.|.|  .....||:||||||.|..:||:|||.|.|
 Frog   207 EQFILKNYNISYYSMRHIDCMGIKKVMEKTFDQLLGRRDRPIHLSFDIDAFDPALAPATGTPVIG 271

  Fly   280 GLTLREGISIVEALRDTKRVQGVDLVEINPKL-GSERDVRTTVESGLEILKSMFGYRRSGRWSNI 343
            |||.|||:.|.|.:.:|..:..:||||:||.| .:..:|:.|....::::.|.||..|.|..:..
 Frog   272 GLTYREGVYITEEIHNTGMLSALDLVEVNPVLAATSEEVKATANLAVDVIASCFGQTREGAHTRA 336

  Fly   344 DT 345
            ||
 Frog   337 DT 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 126/311 (41%)
arg2NP_001072685.1 Arginase 28..324 CDD:212515 126/311 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21811235
eggNOG 1 0.900 E1_COG0010
Hieranoid 1 1.000
Homologene 1 1.000 H906
Inparanoid 1 1.050 237 1.000 Inparanoid score I3162
OMA 1 1.010
OrthoDB 1 1.010 D1179130at2759
OrthoFinder 1 1.000 FOG0001514
OrthoInspector 1 1.000 T600619
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R79
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.