DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and Agmat

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_006539309.1 Gene:Agmat MGIID:1923236 Length:366 Species:Mus musculus

Alignment Length:327 Identity:78/328 (24%)
Similarity:123/328 (38%) Gaps:76/328 (23%)


  Fly    22 STAPREPEQSLGI---------------------IGVPFAKGQA-KQGVELAPDLLRQSSLRQVL 64
            |.:...|.|.:|:                     ||||...|.: :.|....|..:|:.||....
Mouse    48 SPSSESPVQPVGVGVCSMMRLPLQSSPEGLDAAFIGVPLDTGTSNRPGARFGPCRIREESLMLGA 112

  Fly    65 QSSHDG------LVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKL-----M 118
            .:...|      |.:.|.||:..               ::.|..|.....|...:.|..     :
Mouse   113 VNPSTGALPFQSLRVADLGNVNV---------------NLYNLQDSCLLIREAYQNVLAAGCIPL 162

  Fly   119 LVENTQFLAIGGDHAIGFGSV-AGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQ 182
            .::.:.||::|||..|.:..: |...:|.| :.||.:.||.: ......:....|..|....:::
Mouse   163 TLDVSCFLSVGGDQTITYPILQAVAKEHGP-VGLVHVGAHTN-TTDKPREEKVYHRTPFRRSVDE 225

  Fly   183 LRNTWQHAGLQEIAPNCLPKDQLVYIGL----RDIDPYEAFILNKVGIR-YYAMDTIDRVGVPKI 242
                    ||       |...::|.||:    |.:|||.  .....|.| ..|.|...:..||.:
Mouse   226 --------GL-------LDSKRVVQIGIRGSSRTLDPYR--YSRSQGFRVVLAEDCWMKSLVPLM 273

  Fly   243 IEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEI 307
            .|:....  ....:::||.|||||...||.|||....|||..:.:.|:...:.. .|.|.||||:
Mouse   274 AEVRQQM--GGKPLYISFAIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGL-NVVGCDLVEV 335

  Fly   308 NP 309
            :|
Mouse   336 SP 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 75/318 (24%)
AgmatXP_006539309.1 Agmatinase_PAH 61..357 CDD:212538 74/315 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.