DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and arg1

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001038662.1 Gene:arg1 ZFINID:ZDB-GENE-040724-181 Length:341 Species:Danio rerio

Alignment Length:341 Identity:134/342 (39%)
Similarity:204/342 (60%) Gaps:31/342 (9%)


  Fly    16 RLKS-TGSTAP--------REPEQSLGIIGVPFAKGQAKQGVELAPDLLRQSSLRQVLQSSHDGL 71
            ::|| :||.|.        .....|:||||.||:|||.|.||:...||:|.:.|.|.|:.  .|.
Zfish     3 KMKSLSGSRAALHIFRRHLHHQRYSVGIIGAPFSKGQQKDGVQEGADLIRAAGLVQKLKG--QGC 65

  Fly    72 VIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLVENTQFLAIGGDHAIGF 136
            |::||||:.:   |.|...:.:  ..::........|..|...|:.:..:....:.:||||::..
Zfish    66 VVKDYGNVTF---ENLPNDESI--GRLKTPRAVGRANELLSGAVQKIKSDGNTCVMLGGDHSLAI 125

  Fly   137 GSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQLRNTWQHAGLQEIAPN--- 198
            ||::||..:...||::|:|||||||...|:.:|||||.|:|:|:.:|     |:.:.:: ||   
Zfish   126 GSISGHAAYRHELSVLWVDAHADINTPLTTPTGNIHGQPMSYLIHEL-----HSKMPKL-PNFSW 184

  Fly   199 ---CLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDALNPQNK--IHV 258
               |:....:|||||||:||.|.:||..:||:.::|..:||:|:.|::|.|.|.:..:.|  ||:
Zfish   185 LKPCIAAQDVVYIGLRDVDPEEHYILKYLGIKTFSMTEVDRLGIAKVMEQTCDHMFSKVKKPIHL 249

  Fly   259 SFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLGSERD-VRTTVE 322
            ||||||||.:|:|:|||.|.||||.||||.|.|.:..|..:..||:||:|||||...| :::||.
Zfish   250 SFDIDALDPSVSPATGTPVAGGLTYREGIYITEHICQTGLLSAVDMVEVNPKLGRTADEIKSTVN 314

  Fly   323 SGLEILKSMFGYRRSG 338
            :.:::|...||..|.|
Zfish   315 AAVDLLLGCFGRIREG 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 124/308 (40%)
arg1NP_001038662.1 Arginase 28..321 CDD:212515 124/306 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21811879
eggNOG 1 0.900 E1_COG0010
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3335
OMA 1 1.010
OrthoDB 1 1.010 D1179130at2759
OrthoFinder 1 1.000 FOG0001514
OrthoInspector 1 1.000 T596245
orthoMCL 1 0.900 OOG5_128245
Panther 1 1.100 LDO PTHR43782
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R79
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.