DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and agmat

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_002942858.2 Gene:agmat XenbaseID:XB-GENE-997016 Length:389 Species:Xenopus tropicalis

Alignment Length:303 Identity:85/304 (28%)
Similarity:131/304 (43%) Gaps:63/304 (21%)


  Fly    26 REPEQSL--GIIGVPFAKGQA-KQGVELAPDLLRQSS--LRQVLQSSH----DGLVIRDYGNLQY 81
            :|..|.|  ..||||...|.: :.|....|..:|..|  :|:...|:.    :.|::.|.|::  
 Frog   102 QETAQGLDAAFIGVPLDTGTSNRPGARFGPRHIRGESCMVRRYNISTRAAPFESLMVADIGDV-- 164

  Fly    82 AVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLVENTQFLAIGGDHAIGF---GSVAGHL 143
                      .|:.:.:::     :|.| :.|..:.::......|.:||||.|.:   .:||.  
 Frog   165 ----------NVNLYDLKD-----SCRR-IRETYQKIMAAGCIPLTLGGDHTITYPILQAVAE-- 211

  Fly   144 QHTPNLSLVWIDAHADINLHSTSQSGNI-HGMPVSFLLEQLRNTWQHAGLQEIAPNCLPKDQLVY 207
            :|.| :.||.:|||.|..  .|:....| ||.|....:::        ||       |...::|.
 Frog   212 KHGP-VGLVHVDAHTDTG--DTALGEKIYHGTPFRRCVDE--------GL-------LDCKRVVQ 258

  Fly   208 IGLR----DIDPYEAFILNKVGIR-YYAMDTIDRVGVPKIIEMTLD-ALNPQNKIHVSFDIDALD 266
            ||:|    ..|||.  ...:.|.| ..|.|...|..||.:.|:... ...|   :::|||||.||
 Frog   259 IGIRGSSYSADPYG--FCREQGFRVVLAEDCWFRSLVPLMAEVRSQMGAGP---VYISFDIDGLD 318

  Fly   267 SNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINP 309
            .:.||.|||....|||..:.:.|:...|.. .|.|.||||:.|
 Frog   319 PSFAPGTGTPEIAGLTTSQALEIIRGCRGL-NVVGCDLVEVAP 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 83/298 (28%)
agmatXP_002942858.2 Agmatinase_PAH 92..380 CDD:212538 85/304 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.