DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and ARG2

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001163.1 Gene:ARG2 HGNCID:664 Length:354 Species:Homo sapiens

Alignment Length:335 Identity:136/336 (40%)
Similarity:204/336 (61%) Gaps:14/336 (4%)


  Fly    11 SLR--LHRLKSTG-STAPREPEQSLGIIGVPFAKGQAKQGVELAPDLLRQSSLRQVLQSSHDGLV 72
            |||  |.||..|. .:..::...|:.:||.||::||.::|||..|..:|::.|.:.|.|.  |..
Human     2 SLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSL--GCH 64

  Fly    73 IRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLVENTQFLAIGGDHAIGFG 137
            ::|:|:|.:..    :.:..::.:.|.|.......|:.|.|.|...:.:....:.:||||::..|
Human    65 LKDFGDLSFTP----VPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIG 125

  Fly   138 SVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQLRN-TWQHAGLQEIAPNCLP 201
            :::||.:|.|:|.:||:|||||||...|:.|||:||.||||||.:|:: ..|..|...|.| |:.
Human   126 TISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKP-CIS 189

  Fly   202 KDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDAL--NPQNKIHVSFDIDA 264
            ...:|||||||:||.|.|||....|:|::|..|||:|:.|::|.|.|.|  ..|..||:||||||
Human   190 SASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDA 254

  Fly   265 LDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLG-SERDVRTTVESGLEIL 328
            .|..:||:|||.|.||||.|||:.|.|.:.:|..:..:||||:||:|. ||.:.:||....::::
Human   255 FDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVI 319

  Fly   329 KSMFGYRRSG 338
            .|.||..|.|
Human   320 ASSFGQTREG 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 124/303 (41%)
ARG2NP_001163.1 Arginase 26..321 CDD:212515 123/302 (41%)
Substrate binding. {ECO:0000244|PDB:1PQ3, ECO:0000244|PDB:4HZE, ECO:0000244|PDB:4I06, ECO:0000244|PDB:4IE2, ECO:0000244|PDB:4IE3, ECO:0000244|PDB:4IXU, ECO:0000244|PDB:4IXV, ECO:0000269|PubMed:12859189} 145..149 4/4 (100%)
Substrate binding. {ECO:0000244|PDB:1PQ3, ECO:0000244|PDB:4HZE, ECO:0000244|PDB:4I06, ECO:0000244|PDB:4IE2, ECO:0000244|PDB:4IE3, ECO:0000244|PDB:4IXU, ECO:0000244|PDB:4IXV, ECO:0000269|PubMed:12859189} 156..158 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21810277
eggNOG 1 0.900 E1_COG0010
Hieranoid 1 1.000
Homologene 1 1.000 H906
Inparanoid 1 1.050 240 1.000 Inparanoid score I3289
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1179130at2759
OrthoFinder 1 1.000 FOG0001514
OrthoInspector 1 1.000 T608698
orthoMCL 1 0.900 OOG5_128245
Panther 1 1.100 O PTHR43782
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R79
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.